Overview

  • Product name

  • Description

    Rabbit polyclonal to TN-X
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment corresponding to Human TN-X aa 3835-4088. (N-terminal His-tag and GST-tag; Expressed in E.coli).
    Sequence:

    LTGFLTTVPDGPTQLRALNLTEGFAVLHWKPPQNPVDTYDVQVTAPGAPP LQAETPGSAVDYPLHDLVLHTNYTATVRGLRGPNLTSPASITFTTGLEAP RDLEAKEVTPRTALLTWTEPPVRPAGYLLSFHTPGGQNQEILLPGGITSH QLLGLFPSTSYNARLQAMWGQSLLPPVSTSFTTGGLRIPFPRDCGEEMQN GAGASRTSTIFLNGNRERPLNVFCDMETDGGGWLVFQRRMDGQTDFWRDW EDYA


    Database link: P22105

  • Positive control

    • WB: Recombinant human TN-X protein; Pig cerebrum lysate. IHC-P: Human kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab233231 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233231 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 458 kDa.

Target

  • Function

    Appears to mediate interactions between cells and the extracellular matrix. Substrate-adhesion molecule that appears to inhibit cell migration. Accelerates collagen fibril formation. May play a role in supporting the growth of epithelial tumors.
  • Tissue specificity

    Highly expressed in fetal adrenal, in fetal testis, fetal smooth, striated and cardiac muscle. Isoform XB-short is only expressed in the adrenal gland.
  • Involvement in disease

    Tenascin-X deficiency (TNXD) [MIM:606408]: TNXD leads to an Ehlers-Danlos-like syndrome characterized by hyperextensible skin, hypermobile joints, and tissue fragility. Tenascin-X-deficient patients, however, lack atrophic scars, a major diagnostic criteria for classic Ehlers-Danlos. Delayed wound healing, which is also common in classic EDS, is only present in a subset of patients. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Sequence similarities

    Belongs to the tenascin family.
    Contains 19 EGF-like domains.
    Contains 1 fibrinogen C-terminal domain.
    Contains 32 fibronectin type-III domains.
  • Developmental stage

    Expression levels are lower in adults than in children.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • EDS3 antibody
    • Ehlers Danlos like syndrome antibody
    • Growth inhibiting protein 45 antibody
    • Hexabrachion like protein antibody
    • Hexabrachion-like protein antibody
    • HXBL antibody
    • NXB2 antibody
    • Tenascin X antibody
    • Tenascin X precursor antibody
    • Tenascin XB antibody
    • Tenascin XB1 antibody
    • Tenascin XB2 antibody
    • Tenascin-X antibody
    • TENX antibody
    • TENX_HUMAN antibody
    • TN X antibody
    • TN-X antibody
    • TNX antibody
    • TNXB antibody
    • TNXB1 antibody
    • TNXB2 antibody
    • TNXBS antibody
    • VUR8 antibody
    • XB antibody
    • XBS antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for TN-X using ab233231 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-TN-X antibody (ab233231) at 2 µg/ml + Recombinant human TN-X protein

    Predicted band size: 458 kDa

  • Anti-TN-X antibody (ab233231) at 2 µg/ml + Pig cerebrum lysate

    Predicted band size: 458 kDa

References

ab233231 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233231.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up