
  • Product name
    Anti-TNFAIP8L1 antibody
  • Description
    Rabbit polyclonal to TNFAIP8L1
  • Host species
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Chicken, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 136-185 (AKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGS L) of human TNFAIP8L1 (NP_689575)

  • Positive control
    • HepG2 Cell lysate


  • Form
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab85409 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 mg/ml. Predicted molecular weight: 21 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.



  • Anti-TNFAIP8L1 antibody (ab85409) at 1 µg/ml + HepG2 Cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1: 50,000

    Predicted band size: 21 kDa
    Observed band size: <22 kDa (why is the actual band size different from the predicted?)

    Gel concentration: 12%


This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab85409.
Please use the links above to contact us or submit feedback about this product.


Sign up