Recombinant

Recombinant Anti-TNFSF18/GITRL antibody [YGL386] (ab245694)

Overview

  • Product name

    Anti-TNFSF18/GITRL antibody [YGL386]
    See all TNFSF18/GITRL primary antibodies
  • Description

    Rabbit monoclonal [YGL386] to TNFSF18/GITRL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Mouse TNFSF18/GITRL aa 43-173. Recombinant protein injected into DA rats.
    Sequence:

    SLKPTAIESCMVKFELSSSKWHMTSPKPHCVNTTSDGKLKILQSGTYLIY GQVIPVDKKYIKDNAPFVVQIYKKNDVLQTLMNDFQILPIGGVYELHAGD NIYLKFNSKDHIQKTNTYWGIILMPDLPFIS


    Database link: Q7TS55

  • Positive control

    • ICC/IF: Mouse splenocytes.

Properties

Applications

Our Abpromise guarantee covers the use of ab245694 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 10 µg/ml.

Target

  • Function

    Cytokine that binds to TNFRSF18/AITR/GITR. Important for interactions between activated T-lymphocytes and endothelial cells and may modulate T-lymphocyte survival in peripheral tissues.
  • Tissue specificity

    Expressed at high levels in the small intestine, ovary, testis, kidney and endothelial cells.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Activation inducible TNF related ligand antibody
    • Activation-inducible TNF-related ligand antibody
    • AITR ligand antibody
    • AITRL antibody
    • GITR ligand antibody
    • GITRL antibody
    • Glucocorticoid induced TNF related ligand antibody
    • Glucocorticoid induced TNFR related protein ligand antibody
    • Glucocorticoid-induced TNF-related ligand antibody
    • hGITRL antibody
    • MGC138237 antibody
    • TL6 antibody
    • TNF18_HUMAN antibody
    • TNFSF18 antibody
    • TNLG2A antibody
    • Tumor necrosis factor (ligand) superfamily member 18 antibody
    • Tumor necrosis factor ligand 2A antibody
    • Tumor necrosis factor ligand superfamily member 18 antibody
    see all

Images

  • PFA fixed, 0.15% Triton permeabilized mouse splenocytes labeling TNFSF18/GITRL using ab245694 at 10 µg/ml for 1 hour (green) followed by Alexa Fluor® 488 secondary antibody (1 µg/ml), in ICC/IF. The nuclear counter stain is DAPI (blue).

References

ab245694 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab245694.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up