Overview

  • Product name

  • Description

    Rabbit polyclonal to TNIK
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human TNIK aa 601-734.
    Sequence:

    QGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLP TRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLG SQPIRASNPDLRRTEPILESPLQRTSSGSSSSSS


    Database link: Q9UKE5

  • Positive control

    • IHC: Human colon tissue. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224252 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Serine/threonine kinase that acts as an essential activator of the Wnt signaling pathway. Recruited to promoters of Wnt target genes and required to activate their expression. May act by phosphorylating TCF4/TCF7L2. Appears to act upstream of the JUN N-terminal pathway. May play a role in the response to environmental stress. Part of a signaling complex composed of NEDD4, RAP2A and TNIK which regulates neuronal dendrite extension and arborization during development. More generally, it may play a role in cytoskeletal rearrangements and regulate cell spreading.
  • Tissue specificity

    Expressed ubiquitously. Highest levels observed in heart, brain and skeletal muscle. Expressed in normal colonic epithelia and colorectal cancer tissues.
  • Sequence similarities

    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
    Contains 1 CNH domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Autophosphorylated. Autophosphorylation is activated by RAP2A and induces association to the cytoskeletal fraction.
  • Cellular localization

    Nucleus. Cytoplasm. Recycling endosome. Cytoplasm > cytoskeleton. Associated with recycling endosomes and the cytoskeletal fraction upon RAP2A overexpression.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC 2.7.11.1 antibody
    • KIAA0551 antibody
    • Tnik antibody
    • TNIK_HUMAN antibody
    • Traf2 and NCK interacting kinase antibody
    • Traf2 and NCK-interacting protein kinase antibody
    see all

Images

  • Paraffin-embedded human colon tissue stained for TNIK using ab224252 at 1/50 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for TNIK (green) using ab224252 at 4 µg/ml in ICC/IF.

References

ab224252 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224252.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up