Overview

  • Product name

  • Description

    Rabbit polyclonal to TNIP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TNIP1 aa 526-636.
    Sequence:

    RKAKASGERYHVEPHPEHLCGAYPYAYPPMPAMVPHHGFEDWSQIRYPPP PMAMEHPPPLPNSRLFHLPEYTWRLPCGGVRNPNQSSQVMDPPTARPTEP ESPKNDREGPQ


    Database link: Q15025-1

  • Positive control

    • IHC-P: Human skeletal muscle tissue. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236984 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Interacts with zinc finger protein A20/TNFAIP3 and inhibits TNF-induced NF-kappa-B-dependent gene expression by interfering with an RIP- or TRAF2-mediated transactivation signal (By similarity). Increases cell surface CD4(T4) antigen expression. Interacts with HIV-1 matrix protein and is packaged into virions and overexpression can inhibit viral replication. May regulate matrix nuclear localization, both nuclear import of PIC (Preintegration complex) and export of GAG polyprotein and viral genomic RNA during virion production.
  • Tissue specificity

    Ubiquitous. Strongly expressed in peripheral blood lymphocytes, spleen and skeletal muscle, and is weakly expressed in the brain.
  • Cellular localization

    Cytoplasm. Nucleus. Shuttles between the nucleus and cytoplasm in a CRM1-dependent manner.
  • Information by UniProt
  • Database links

  • Alternative names

    • ABIN 1 antibody
    • HIV-1 Nef-interacting protein antibody
    • hVAN antibody
    • KIAA0113 antibody
    • Naf1 antibody
    • Nef-associated factor 1 antibody
    • Nip40-1 antibody
    • TNFAIP3 interacting protein 1 antibody
    • TNFAIP3-interacting protein 1 antibody
    • TNIP-1 antibody
    • Tnip1 antibody
    • TNIP1_HUMAN antibody
    • VAN antibody
    • Virion-associated nuclear shuttling protein antibody
    see all

Images

  • Paraffin-embedded human skeletal muscle tissue stained for TNIP1 with ab236984 at 1/300 dilution in immunohistochemical analysis.

  • HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for TNIP1 (green) using ab236984 at 1/100 dilution in ICC/IF.

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L). Counterstained with DAPI.

References

ab236984 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236984.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up