Overview

  • Product name

    Anti-TNNC1 antibody [C5]
    See all TNNC1 primary antibodies
  • Description

    Mouse monoclonal [C5] to TNNC1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Human, Pig
  • Immunogen

    Recombinant full length protein corresponding to Human TNNC1 aa 1-161. Two N-terminal Tags, His-tag and GST-tag. (Expressed in E.coli).
    Sequence:

    MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQ NPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDL FRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDY DEFLEFMKGVE


    Database link: P63316

  • Positive control

    • WB: Recombinant human TNNC1 protein; Human lung lysate; Pig heart and skeletal muscle lysate; Mouse heart tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab239578 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml.

Target

  • Function

    Troponin is the central regulatory protein of striated muscle contraction. Tn consists of three components: Tn-I which is the inhibitor of actomyosin ATPase, Tn-T which contains the binding site for tropomyosin and Tn-C. The binding of calcium to Tn-C abolishes the inhibitory action of Tn on actin filaments.
  • Involvement in disease

    Defects in TNNC1 are the cause of cardiomyopathy dilated type 1Z (CMD1Z) [MIM:611879]. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death.
    Defects in TNNC1 are the cause of cardiomyopathy familial hypertrophic type 13 (CMH13) [MIM:613243]. A hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death.
  • Sequence similarities

    Belongs to the troponin C family.
    Contains 4 EF-hand domains.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cardiac troponin C antibody
    • CMD1Z antibody
    • CMH13 antibody
    • slow skeletal and cardiac muscles antibody
    • Slow twitch skeletal/cardiac muscle troponin C antibody
    • TN-C antibody
    • TNC antibody
    • TNNC antibody
    • Tnnc1 antibody
    • TNNC1 troponin C type 1 (slow) antibody
    • TNNC1_HUMAN antibody
    • Troponin C antibody
    • troponin C type 1 (slow) antibody
    • Troponin C, slow skeletal and cardiac muscles antibody
    • Troponin C1, slow antibody
    see all

Images

  • All lanes : Anti-TNNC1 antibody [C5] (ab239578) at 3 µg/ml

    Lane 1 : Human lung tissue lysate
    Lane 2 : Pig heart tissue lysate
    Lane 3 : Pig skeletal muscle tissue lysate
    Lane 4 : Mouse heart tissue lysate

    Secondary
    All lanes : HRP-Linked Rabbit Anti-Mouse IgG at 1/5000 dilution
  • Anti-TNNC1 antibody [C5] (ab239578) at 5 µg/ml + Recombinant human TNNC1 protein

References

ab239578 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239578.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up