Overview

  • Product name

  • Description

    Rabbit polyclonal to TNNI1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Pig
    Predicted to work with: Mouse, Rabbit, Human
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Rat TNNI1 aa 1-187. (Expressed in E.coli)
    Sequence:

    MPEVERKSKITASRKLMLKSLMLAKAKECWEQEHEEREAEKVRYLSERIP TLQTRGLSLSALQDLCRELHAKVEVVDEERYDIEAKCLHNTREIKDLKLK VLDLRGKFKRPPLRRVRVSADAMLRALLGSKHKVSMDLRANLKSVKKEDT EKERPVEVGDWRKNVEAMSGMEGRKKMFDAAKSPTLQ


    Database link: P13413

  • Positive control

    • WB: Recombinant rat TNNI1 protein; Pig and rat heart and skeletal muscle lysates. IHC-P: Rat skeletal muscle tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231720 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231720 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 22 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.
  • Tissue specificity

    Highest levels observed in human skeletal muscle (e.g. gastrocnemious muscle), differentiated cultures of primary human muscle cells and rhabdomyosarcoma cells cultured in low serum medium. Expressed in C2 muscle cell myoblasts and myotubes.
  • Sequence similarities

    Belongs to the troponin I family.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2700018B22Rik antibody
    • AI747285 antibody
    • DKFZp451O223 antibody
    • si:dz182n13.3 antibody
    • slow skeletal muscle antibody
    • slow-twitch isoform antibody
    • SSTNI antibody
    • TNN1 antibody
    • Tnni1 antibody
    • TNNI1_HUMAN antibody
    • Troponin I antibody
    • Troponin I slow skeletal muscle antibody
    • Troponin I slow twitch isoform antibody
    • troponin I type 1 (skeletal, slow) antibody
    • Troponin I, slow isoform antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat skeletal muscle tissue stained for TNNI1 using ab231720 at 20 µg/ml in immunohistochemical analysis.

  • Anti-TNNI1 antibody (ab231720) at 2 µg/ml + Pig skeletal muscle lysate.

    Predicted band size: 22 kDa

  • Anti-TNNI1 antibody (ab231720) at 1 µg/ml + Rat heart lysate.

    Predicted band size: 22 kDa

  • Anti-TNNI1 antibody (ab231720) at 2 µg/ml + Rat skeletal muscle lysate.

    Predicted band size: 22 kDa

  • Anti-TNNI1 antibody (ab231720) at 2 µg/ml + Pig heart lysate.

    Predicted band size: 22 kDa

  • Anti-TNNI1 antibody (ab231720) at 2 µg/ml + Recombinant rat TNNI1 protein.

    Predicted band size: 22 kDa

References

This product has been referenced in:

  • Wu L  et al. Myricetin improves endurance capacity by inducing muscle fiber type conversion via miR-499. Nutr Metab (Lond) 16:27 (2019). Read more (PubMed: 31073320) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231720.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up