Overview

  • Product name

  • Description

    Rabbit polyclonal to TNP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Pig
  • Immunogen

    Recombinant full length protein corresponding to Human TNP1 aa 2-55.
    Sequence:

    STSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNY RSHL


    Database link: P09430

  • Positive control

    • IHC-P: Human testis tissue.
  • General notes

    Previously labelled as Transition Protein 1.

Properties

Applications

Our Abpromise guarantee covers the use of ab224567 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    In the elongating spermatids of mammals, the conversion of nucleosomal chromatin to the compact, non-nucleosomal form found in the sperm nucleus is associated with the appearance of a small set of basic chromosomal transition proteins.
  • Tissue specificity

    Testis.
  • Sequence similarities

    Belongs to the nuclear transition protein 1 family.
  • Cellular localization

    Nucleus. Chromosome.
  • Information by UniProt
  • Database links

  • Alternative names

    • Spermatid nuclear transition protein 1 antibody
    • Spermatid nuclear transition protein1 antibody
    • STP 1 antibody
    • STP-1 antibody
    • STP1 antibody
    • STP1_HUMAN antibody
    • TNP 1 antibody
    • TNP1 antibody
    • TP 1 antibody
    • TP-1 antibody
    • TP1 antibody
    • Transition protein 1 (during histone to protamine replacement) antibody
    • Transition protein1 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for TNP1 using ab224567 at 1/200 dilution in immunohistochemical analysis.

References

ab224567 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224567.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up