Anti-TOB antibody (ab236859)
Key features and details
- Rabbit polyclonal to TOB
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-TOB antibody -
Description
Rabbit polyclonal to TOB -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human TOB aa 42-175.
Sequence:GHWYPEKPYKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLS VWIDPFEVSYQIGEKGPVKVLYVDDNNENGCELDKEIKNSFNPEAQVFMP ISDPASSVSSSPSPPFGHSAAVSPTFMPRSTQPL
Database link: P50616 -
Positive control
- IHC-P: Human small intestine tissue. ICC/IF: A549 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab236859 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | 1/50 - 1/200. | |
IHC-P | 1/20 - 1/200. |
Target
-
Relevance
The Tob/Btg family of proteins consists of a large number of members. These proteins have a common domain in their amino terminal end and may have anti-proliferative activity in various cell types. The Tob protein was identified in a search for molecules that interact with the receptor tyrosine kinase ErbB2. Active ErbB2 has a negative effect on the anti-proliferative activity of Tob. However, Tob is phosphorylated on serine and threonine residues but not on tyrosine, suggesting that active ErbB2 activates a Ser/Thr kinase that phosphorylates Tob. Unphosphorylated Tob suppresses expression of cyclin D1. It was shown that active p90Rsk1 kinase (known to be activated by protein-tyrosine kinase receptor) phosphorylates Tob on serine and threonine residues in vitro. In addition, Erk1/Erk2 MAP kinases phosphorylate Tob in vivo and in vitro, resulting in suppression of the anti-proliferative activity of Tob. Homozygous Tob knockout mice develop greater bone mass resulting from increased numbers of osteoblasts. Furthermore, it has been shown in osteoblasts, that upon BMP2 (bone morphogenetic protein) activation, Tob associates with receptor regulated Smads (Smad 1, 5, and 8). Thus, osteoblast proliferation and differentiation is negatively regulated by Tob protein through the Smad proteins. -
Database links
- Entrez Gene: 10140 Human
- Entrez Gene: 22057 Mouse
- Entrez Gene: 170842 Rat
- Omim: 605523 Human
- SwissProt: P50616 Human
- SwissProt: Q61471 Mouse
- SwissProt: Q8R5K6 Rat
- Unigene: 531550 Human
-
Alternative names
- APRO 6 antibody
- APRO6 antibody
- MGC104792 antibody
see all
Images
-
Paraffin-embedded human small intestine tissue stained for TOB using ab236859 at 1/100 dilution in immunohistochemical analysis.
-
A549 (human lung carcinoma cell line) cells stained for TOB (green) using ab236859 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (1)
ab236859 has been referenced in 1 publication.
- Wang J et al. LncRNA NR2F1-AS1 Regulates miR-371a-3p/TOB1 Axis to Suppress the Proliferation of Colorectal Cancer Cells. Cancer Biother Radiopharm N/A:N/A (2020). PubMed: 32407174