Anti-TOB2 antibody (ab236087)
Key features and details
- Rabbit polyclonal to TOB2
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-TOB2 antibody
See all TOB2 primary antibodies -
Description
Rabbit polyclonal to TOB2 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse -
Immunogen
Recombinant fragment corresponding to Human TOB2 aa 1-70.
Sequence:MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKKKYEGHWYPEKPL KGSGFRCVHIGEMVDPVVEL
Database link: Q14106 -
Positive control
- IHC-P: Human gastric cancer and skeletal muscle tissues.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab236087 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. |
Target
-
Function
Anti-proliferative protein inhibits cell cycle progression from the G0/G1 to S phases. -
Tissue specificity
Ubiquitous. -
Sequence similarities
Belongs to the BTG family. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 10766 Human
- Entrez Gene: 57259 Mouse
- Omim: 607396 Human
- SwissProt: Q14106 Human
- SwissProt: Q9JM55 Mouse
- Unigene: 474978 Human
- Unigene: 323595 Mouse
-
Alternative names
- KIAA1663 antibody
- Protein Tob2 antibody
- Protein Tob4 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TOB2 antibody (ab236087)
Paraffin-embedded human skeletal muscle tissue stained for TOB2 using ab236087 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TOB2 antibody (ab236087)
Paraffin-embedded human gastric cancer tissue stained for TOB2 using ab236087 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab236087 has not yet been referenced specifically in any publications.