Overview

  • Product name

  • Description

    Rabbit polyclonal to Tollip
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human Tollip aa 147-236.
    Sequence:

    VEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMVMPPQPVVLMPTVYQQG VGYVPITGMPAVCSPGMVPVALPPAAVNAQPRCSEEDLKA


    Database link: Q9H0E2

  • Positive control

    • IHC-P: Human small intestine tissue. WB: RT-4, U-251 MG and NBT-II cell lysates. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab223763 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 30 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Component of the signaling pathway of IL-1 and Toll-like receptors. Inhibits cell activation by microbial products. Recruits IRAK1 to the IL-1 receptor complex. Inhibits IRAK1 phosphorylation and kinase activity.
  • Sequence similarities

    Belongs to the tollip family.
    Contains 1 C2 domain.
    Contains 1 CUE domain.
  • Post-translational
    modifications

    Phosphorylated by IRAK1 upon stimulation by IL-1 or microbial products.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Adapter protein antibody
    • FLJ33531 antibody
    • IL 1RAcPIP antibody
    • IL1RAcPIP antibody
    • TOLIP antibody
    • TOLIP_HUMAN antibody
    • Toll interacting protein antibody
    • Toll-interacting protein antibody
    • tollip antibody
    see all

Images

  • All lanes : Anti-Tollip antibody (ab223763) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-2 OS (human brain glioma cell line) cell lysate

    Predicted band size: 30 kDa

  • Paraffin-embedded human small intestine tissue stained for Tollip using ab223763 at 1/500 dilution in immunohistochemical analysis

  • All lanes : Anti-Tollip antibody (ab223763) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line) whole cell lysate
    Lane 2 : NBT-II whole cell lysate

    Predicted band size: 30 kDa

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for Tollip (green) using ab223763 at 4 µg/ml in ICC/IF.

References

ab223763 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223763.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up