Overview

  • Product name

  • Description

    Rabbit polyclonal to TOM1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human TOM1 aa 204-380.
    Sequence:

    LSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLEL LQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFER FRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVRAGL QSLEASGRLEDEFDMFALTRGSSLADQ


    Database link: O60784

  • Positive control

    • WB: RT-4, EFO-21 and A431 cell lysate; human liver and tonsil tissue lysate. ICC/IF: U-2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab219972 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500. Predicted molecular weight: 54 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Relevance

    Function: May be involved in intracellular trafficking. Probable association with membranes. Tissue specificity: Widely expressed. Highly expressed in skeletal muscle, heart, placenta and liver. Similarity: Belongs to the TOM1 family. Contains 1 GAT domain. Contains 1 VHS domain.
  • Cellular localization

    Cytoplasm. Membrane; Peripheral membrane protein
  • Database links

  • Alternative names

    • FLJ33404 antibody
    • OTTHUMP00000028777 antibody
    • Target of myb 1 antibody
    • Target of Myb protein 1 antibody
    • Target of myb1 antibody
    • TOM 1 antibody
    • TOM1 antibody
    • TOM1_HUMAN antibody
    see all

Images

  • All lanes : Anti-TOM1 antibody (ab219972) at 1/250 dilution

    Lane 1 : RT-4 cell line lysate
    Lane 2 : EFO-21 cell line lysate
    Lane 3 : A431 cell line lysate
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate

    Predicted band size: 54 kDa

  • Immunofluorescent analysis of paraformaldehyde-fixed, Triton X-100 permeabilized U-2 OS cells labeling TOM1 with ab219972 at 4 μg/mL dilution (green).

References

ab219972 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219972.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up