Overview

  • Product name

    Anti-TOM1L1 antibody - N-terminal
    See all TOM1L1 primary antibodies
  • Description

    Rabbit polyclonal to TOM1L1 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Guinea pig, Cow, Cat, Dog, Human, Pig
  • Immunogen

    Synthetic peptide within Mouse TOM1L1 aa 42-91 (N terminal). The exact sequence is proprietary. Isoform 3
    Sequence:

    INTTQDGPKDAVKALKKRISKNYNHKEIQLSLSLIDMCVQNCGPSFQSLI


    Database link: Q923U0-3

  • Positive control

    • Mouse Muscle lysates

Properties

Applications

Our Abpromise guarantee covers the use of ab178827 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 44 kDa.

Target

  • Function

    Probable adapter protein involved in signaling pathways. Interacts with the SH2 and SH3 domains of various signaling proteins when it is phosphorylated. May promotes FYN activation, possibly by disrupting intramolecular SH3-dependent interactions.
  • Sequence similarities

    Belongs to the TOM1 family.
    Contains 1 GAT domain.
    Contains 1 VHS domain.
  • Post-translational
    modifications

    Phosphorylated on tyrosines by FYN (By similarity). Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Golgi apparatus > Golgi stack. Endosome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2310045L10Rik antibody
    • C80573 antibody
    • OK/KNS CL.3 antibody
    • Src activating and signaling molecule antibody
    • Src activating and signaling molecule protein antibody
    • Src-activating and signaling molecule protein antibody
    • SRCASM antibody
    • Target of Myb like protein 1 antibody
    • Target of Myb-like protein 1 antibody
    • Target of myb1 (chicken) homolog like 1 antibody
    • Target of myb1 (chicken) like 1 antibody
    • Target of myb1 like 1 antibody
    • TM1L1_HUMAN antibody
    • TOM1 L1 antibody
    • TOM1 like protein 1 antibody
    • TOM1-like protein 1 antibody
    • TOM1L1 antibody
    • TOM1L1 protein antibody
    see all

Images

  • Anti-TOM1L1 antibody - N-terminal (ab178827) at 1 µg/ml + Mouse Muscle lysates at 10 µg

    Predicted band size: 44 kDa

References

ab178827 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab178827.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up