Overview

  • Product name

    Anti-TOM5 antibody
  • Description

    Rabbit polyclonal to TOM5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human TOM5 aa 3-49.
    Sequence:

    RIEGLAPKLDPEEMKRKMREDVISSIRNFLIYVALLRVTPFILKKLD


    Database link: Q8N4H5

  • Positive control

    • Human colon tissue; HeLa cells.
  • General notes

    Previously labelled as TOM5. 

Properties

Applications

Our Abpromise guarantee covers the use of ab151037 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/10 - 1/20. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

Images

  • Immunofluorescent analysis of PFA/Triton X-100 fixed Human HeLa cells, labeling TOM5 with ab151037 at 4 &microg/ml.

  • Immunohistochemical analysis of Paraffin-Embedded Human colon tissue, labeling TOM5 with ab151037 at 1/10 dilution.

References

This product has been referenced in:

  • Lerbs T  et al. Inhibition of Six1 affects tumour invasion and the expression of cancer stem cell markers in pancreatic cancer. BMC Cancer 17:249 (2017). Read more (PubMed: 28388884) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151037.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up