Overview

  • Product name

  • Description

    Rabbit polyclonal to TOM70
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human, Pig
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human TOM70 aa 333-608. (Expressed in E.coli).
    Sequence:

    LLRATFYLLIGNANAAKPDLDKVISLKEANVKLRANALIKRGSMYMQQQQ PLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQVEEAVADFDECIRLRP ESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKFPRCAEGYALY AQALTDQQQFGKADEMYDKCIDLEPDNATTYVHKGLLQLQWKQDLDRGLE LISKAIEIDNKCDFAYETMGTIEVQRGNMEKAIDMFNKAINLAKSEMEMA HLYSLCDAAHAQTEVAKKYGLKPPTL


    Database link: O94826

  • Positive control

    • IHC-P: Human cerebrum and liver tissues. WB: Pig brain, liver and heart lysates; Mouse brain lysate; Recombinant human TOM70 protein.
  • General notes

    Protein previously labeled as TOMM70A.

Properties

Applications

Our Abpromise guarantee covers the use of ab233407 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 5 - 20 µg/ml. Predicted molecular weight: 67 kDa.
IHC-P Use a concentration of 0.5 - 20 µg/ml.

Target

Images

  • Paraffin-embedded human cerebrum tissue stained for TOM70 using ab233407 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human liver tissue stained for TOM70 using ab233407 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-TOM70 antibody (ab233407) at 1 µg/ml + Recombinant human TOM70 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 67 kDa

  • All lanes : Anti-TOM70 antibody (ab233407) at 1 µg/ml

    Lane 1 : Pig brain lysate
    Lane 2 : Pig liver lysate
    Lane 3 : Pig heart lysate
    Lane 4 : Mouse brain lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 67 kDa

References

ab233407 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233407.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up