Anti-TOM70 antibody (ab233407)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-TOM70 antibody
See all TOM70 primary antibodies -
Description
Rabbit polyclonal to TOM70 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human, Pig
Predicted to work with: Rat -
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Human TOM70 aa 333-608. (Expressed in E.coli).
Sequence:LLRATFYLLIGNANAAKPDLDKVISLKEANVKLRANALIKRGSMYMQQQQ PLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQVEEAVADFDECIRLRP ESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKFPRCAEGYALY AQALTDQQQFGKADEMYDKCIDLEPDNATTYVHKGLLQLQWKQDLDRGLE LISKAIEIDNKCDFAYETMGTIEVQRGNMEKAIDMFNKAINLAKSEMEMA HLYSLCDAAHAQTEVAKKYGLKPPTL
Database link: O94826 -
Positive control
- IHC-P: Human cerebrum and liver tissues. WB: Pig brain, liver and heart lysates; Mouse brain lysate; Recombinant human TOM70 protein.
-
General notes
Protein previously labeled as TOMM70A.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab233407 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab233407 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 5 - 20 µg/ml. Predicted molecular weight: 67 kDa. | |
IHC-P | Use a concentration of 0.5 - 20 µg/ml. |
Target
-
Function
Receptor that accelerates the import of all mitochondrial precursor proteins. -
Sequence similarities
Belongs to the Tom70 family.
Contains 10 TPR repeats. -
Cellular localization
Mitochondrion outer membrane. - Information by UniProt
-
Database links
- Entrez Gene: 9868 Human
- Entrez Gene: 28185 Mouse
- Entrez Gene: 304017 Rat
- Omim: 606081 Human
- SwissProt: O94826 Human
- SwissProt: Q9CZW5 Mouse
- SwissProt: Q75Q39 Rat
- Unigene: 227253 Human
see all -
Alternative names
- FLJ9047 antibody
- Mitochondrial import receptor subunit TOM70 antibody
- Mitochondrial precursor proteins import receptor antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TOM70 antibody (ab233407)
Paraffin-embedded human cerebrum tissue stained for TOM70 using ab233407 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TOM70 antibody (ab233407)
Paraffin-embedded human liver tissue stained for TOM70 using ab233407 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Anti-TOM70 antibody (ab233407) at 1 µg/ml + Recombinant human TOM70 protein
Secondary
HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
Predicted band size: 67 kDa -
All lanes : Anti-TOM70 antibody (ab233407) at 1 µg/ml
Lane 1 : Pig brain lysate
Lane 2 : Pig liver lysate
Lane 3 : Pig heart lysate
Lane 4 : Mouse brain lysate
Secondary
All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
Predicted band size: 67 kDa
Datasheets and documents
References
ab233407 has not yet been referenced specifically in any publications.