Anti-TOM70 antibody (ab233407)
Key features and details
- Rabbit polyclonal to TOM70
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Human, Pig
- Isotype: IgG
Overview
-
Product name
Anti-TOM70 antibody
See all TOM70 primary antibodies -
Description
Rabbit polyclonal to TOM70 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human, Pig
Predicted to work with: Rat
-
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Human TOM70 aa 333-608. (Expressed in E.coli).
Sequence:LLRATFYLLIGNANAAKPDLDKVISLKEANVKLRANALIKRGSMYMQQQQ PLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQVEEAVADFDECIRLRP ESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKFPRCAEGYALY AQALTDQQQFGKADEMYDKCIDLEPDNATTYVHKGLLQLQWKQDLDRGLE LISKAIEIDNKCDFAYETMGTIEVQRGNMEKAIDMFNKAINLAKSEMEMA HLYSLCDAAHAQTEVAKKYGLKPPTL
Database link: O94826 -
Positive control
- IHC-P: Human cerebrum and liver tissues. WB: Pig brain, liver and heart lysates; Mouse brain lysate; Recombinant human TOM70 protein.
-
General notes
Protein previously labeled as TOMM70A.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab233407 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab233407 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 5 - 20 µg/ml. Predicted molecular weight: 67 kDa. | |
| IHC-P | Use a concentration of 0.5 - 20 µg/ml. |
Target
-
Function
Receptor that accelerates the import of all mitochondrial precursor proteins. -
Sequence similarities
Belongs to the Tom70 family.
Contains 10 TPR repeats. -
Cellular localization
Mitochondrion outer membrane. - Information by UniProt
-
Database links
- Entrez Gene: 9868 Human
- Entrez Gene: 28185 Mouse
- Entrez Gene: 304017 Rat
- Omim: 606081 Human
- SwissProt: O94826 Human
- SwissProt: Q9CZW5 Mouse
- SwissProt: Q75Q39 Rat
- Unigene: 227253 Human
see all -
Alternative names
- FLJ9047 antibody
- Mitochondrial import receptor subunit TOM70 antibody
- Mitochondrial precursor proteins import receptor antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TOM70 antibody (ab233407)Paraffin-embedded human cerebrum tissue stained for TOM70 using ab233407 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TOM70 antibody (ab233407)Paraffin-embedded human liver tissue stained for TOM70 using ab233407 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Western blot - Anti-TOM70 antibody (ab233407)Anti-TOM70 antibody (ab233407) at 1 µg/ml + Recombinant human TOM70 protein
Secondary
HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
Predicted band size: 67 kDa -
Western blot - Anti-TOM70 antibody (ab233407)All lanes : Anti-TOM70 antibody (ab233407) at 1 µg/ml
Lane 1 : Pig brain lysate
Lane 2 : Pig liver lysate
Lane 3 : Pig heart lysate
Lane 4 : Mouse brain lysate
Secondary
All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
Predicted band size: 67 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab233407 has not yet been referenced specifically in any publications.
