Overview

  • Product name

    Anti-TOMM22/TOM22 antibody
    See all TOMM22/TOM22 primary antibodies
  • Description

    Mouse monoclonal to TOMM22/TOM22
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, Flow Cyt, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein (GST-tag) corresponding to Human TOMM22/TOM22 aa 1-143.
    Sequence:

    MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWG LTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVV FETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI

  • General notes

    Previously labelled as TOMM22. 

    This product was changed from ascites to tissue culture supernatant on 15 May 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

Properties

Applications

Our Abpromise guarantee covers the use of ab57523 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 15 kDa.
IHC-P Use at an assay dependent concentration.
Flow Cyt Use at an assay dependent concentration.

ab170191 - Mouse monoclonal IgG2a, is suitable for use as an isotype control with this antibody.

 

ICC/IF Use at an assay dependent concentration.

Target

  • Cellular localization

    Mitochondrion outer membrane; Single-pass membrane protein
  • Database links

  • Alternative names

    • 1C9 2 antibody
    • hTom 22 antibody
    • hTom22 antibody
    • Mitochondrial import receptor subunit TOM 22 homolog antibody
    • Mitochondrial import receptor subunit TOM22 homolog antibody
    • Mitochondrial import receptor Tom 22 antibody
    • Mitochondrial import receptor Tom22 antibody
    • MST 065 antibody
    • MST065 antibody
    • MSTP 065 antibody
    • MSTP065 antibody
    • TOM 22 antibody
    • TOM22 antibody
    • TOMM 22 antibody
    • TOMM22 antibody
    • Translocase of outer membrane 22 kDa subunit homolog antibody
    • Translocase of outer mitochondrial membrane 22 homolog antibody
    see all

Images

  • TOMM22/TOM22 antibody (ab57523) used in immunohistochemistry at 3ug/ml on formalin fixed and paraffin embedded human small Intestine.

    This image was generated using the ascites version of the product.

  • TOMM22/TOM22 antibody (ab57523) at 1ug/lane + NIH/3T3 cell lysate at 25ug/lane.

    This image was generated using the ascites version of the product.

  • Anti-TOMM22/TOM22 antibody (ab57523) + immunogen peptide, Full length TOMM22 / TOM22 with GST tag.

    Predicted band size: 15 kDa



    GST tag MW is 26kDa.

  • Immunocytochemistry/ Immunofluorescence of TOMM22 in HeLa cell using ab57523 at 10 μg/ml.

  • ICC/IF image of ab57523 stained HeLa cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab57523, 10µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-mouse IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

    This image was generated using the ascites version of the product.

  • Overlay histogram showing HeLa cells stained with ab57523 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab57523, 1µg/1x106 cells) for 30 min at 22°C. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22°C. Isotype control antibody (black line) was mouse IgG2a [ICIGG2A] (ab91361, 1µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed.

    This image was generated using the ascites version of the product.

References

This product has been referenced in:

  • Thai PN  et al. Cardiac-specific Conditional Knockout of the 18-kDa Mitochondrial Translocator Protein Protects from Pressure Overload Induced Heart Failure. Sci Rep 8:16213 (2018). Read more (PubMed: 30385779) »
  • Zeitlow K  et al. The biological foundation of the genetic association of TOMM40 with late-onset Alzheimer's disease. Biochim Biophys Acta 1863:2973-2986 (2017). Read more (PubMed: 28768149) »
See all 9 Publications for this product

Customer reviews and Q&As

1-4 of 4 Abreviews or Q&A

Question
Answer

Hello!

We also do recommend using RIPA buffer rather than NP40 for mitochondrial targets, would this be something you are able to do with your samples?

Read More

Answer

Thank you very much for your patience while I was in discussion with lab.

My colleague has confirmed that, they tested ab57523 with PC-12, Raw 264.7 and NIH/3T3 cells in western blot and they haven't observed any band at 88kDa. The band they observed was near ˜30kDa.

For ab48139 they suggested the lower bands might be degradation product or uncharacterized proteins that cross-react with the antibody.

I am sorry I am unable to find a more definite explanation of the bands you have been observing. We have also received no complaints for these antibodies so protocol troubleshooting might help in this case. Please try tweaking the dilution factor, lysate concentration etc.

I hope this information will be helpful. Should you have any other question please do not hesitate to contact me.

Read More

Answer

Thank you for providing this extra information. The alignment shows a very low homology between the yeast protein and the human TOMM2 protein (www.uniprot.org/uniprot/Q9NS69), 16% only. This result suggests that unfortunately the TOMM2 antibody ab57523 is not suitable for the detection of the yeast protein. I hope this information is nevertheless useful for you. Do not hesitate to contact us again if you have other questions.

Read More

Answer

Thank you very much for your inquiry. Unfortunately we do not have an antibody in our catalogue for the moment for which we can suggest a crossreactivity with the yeast SEC61 proteins. I am very sorry for this. Please see further below for the alignment scores. For the TOMM22 protein, I could not find the sequence in UniProt neither. Can the customer maybe provide this? In the case we can not make an alignment, I am willing to provide a testing discount. alignment scores for SEC61 antibodies: ab15575 44% yeast/ 61% schp http://www.ebi.ac.uk/Tools/services/web_clustalw2/toolresult.ebi?tool=clustalw2&jobId=clustalw2-I20110905-173253-0036-74194366-pg ab77789 and ab15037 14% yeast/schp http://www.ebi.ac.uk/Tools/services/web_clustalw2/toolresult.ebi?tool=clustalw2&jobId=clustalw2-I20110905-173532-0061-46398952-pg ab97537 15% yeast/schp http://www.ebi.ac.uk/Tools/services/web_clustalw2/toolresult.ebi?tool=clustalw2&jobId=clustalw2-I20110905-173733-0295-24017780-pg ab1327 14% yeast/schp http://www.ebi.ac.uk/Tools/services/web_clustalw2/toolresult.ebi?tool=clustalw2&jobId=clustalw2-I20110905-173823-0394-68897710-pg Unfortunately I have not found the SEC61B and G yeast sequences on UniProt and can therefore not provide an alignment. Do you have these sequences? I am sorry for not being able to be more helpful on this occasion. Please provide me with the sequences if you can in order for me to do the alignments. Thank you very much.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up