Overview

  • Product name

  • Description

    Rabbit polyclonal to TOMM34
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human TOMM34 aa 1-309.
    Sequence:

    MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEE SVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEK YPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLV PVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEG NELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDC TEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKL RQEVKQNLH


    Database link: Q15785

  • Positive control

    • WB: Mouse gonadal tissue lysate; A549, PC-3 and A-375 whole cell lysates. IHC-P: Human pancreatic cancer and testis tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230103 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 35 kDa (predicted molecular weight: 35 kDa).
IHC-P 1/20 - 1/200.

Target

  • Function

    Plays a role in the import of cytosolically synthesized preproteins into mitochondria. Binds the mature portion of precursor proteins. Interacts with cellular components, and possesses weak ATPase activity. May be a chaperone-like protein that helps to keep newly synthesized precursors in an unfolded import compatible state.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the Tom34 family.
    Contains 6 TPR repeats.
  • Cellular localization

    Cytoplasm. Mitochondrion outer membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • hTom34 antibody
    • HTOM34P antibody
    • Mitochondrial import receptor subunit TOM34 antibody
    • OTTHUMP00000031079 antibody
    • Outer mitochondrial membrane translocase (34kD) antibody
    • TOM 34 antibody
    • TOM34 antibody
    • TOM34_HUMAN antibody
    • TOMM 34 antibody
    • TOMM34 antibody
    • Translocase of outer membrane 34 kDa subunit antibody
    • Translocase of outer mitochondrial membrane 34 antibody
    • URCC 3 antibody
    • URCC3 antibody
    see all

Images

  • All lanes : Anti-TOMM34 antibody (ab230103) at 1/1000 dilution

    Lane 1 : Mouse gonadal tissue lysate
    Lane 2 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 3 : PC-3 (human prostate adenocarcinoma cell line) whole cell lysate
    Lane 4 : A-375 (human malignant melanoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 35 kDa

  • Paraffin-embedded human testis tissue stained for TOMM34 using ab230103 at a 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreatic cancer tissue stained for TOMM34 using ab230103 at a 1/100 dilution in immunohistochemical analysis.

References

ab230103 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230103.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up