Overview

  • Product name

  • Description

    Rabbit polyclonal to TOMM34
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human TOMM34 aa 1-309.
    Sequence:

    MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEE SVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEK YPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLV PVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEG NELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDC TEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKL RQEVKQNLH


    Database link: Q15785

  • Positive control

    • IHC-P: Human testis and pancreatic cancer tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230277 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Plays a role in the import of cytosolically synthesized preproteins into mitochondria. Binds the mature portion of precursor proteins. Interacts with cellular components, and possesses weak ATPase activity. May be a chaperone-like protein that helps to keep newly synthesized precursors in an unfolded import compatible state.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the Tom34 family.
    Contains 6 TPR repeats.
  • Cellular localization

    Cytoplasm. Mitochondrion outer membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • hTom34 antibody
    • HTOM34P antibody
    • Mitochondrial import receptor subunit TOM34 antibody
    • OTTHUMP00000031079 antibody
    • Outer mitochondrial membrane translocase (34kD) antibody
    • TOM 34 antibody
    • TOM34 antibody
    • TOM34_HUMAN antibody
    • TOMM 34 antibody
    • TOMM34 antibody
    • Translocase of outer membrane 34 kDa subunit antibody
    • Translocase of outer mitochondrial membrane 34 antibody
    • URCC 3 antibody
    • URCC3 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for TOMM34 using ab230277 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreatic cancer tissue stained for TOMM34 using ab230277 at 1/100 dilution in immunohistochemical analysis.

References

ab230277 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230277.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up