Overview

  • Product name

  • Description

    Rabbit polyclonal to TOMM40
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human TOMM40 aa 1-361.
    Sequence:

    MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTST SRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEG VKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVL VGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFT AAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSL AGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVS FGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKN KFQCGFGLTIG


    Database link: O96008

  • Positive control

    • IHC-P: Human lung and placenta tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab235985 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Channel-forming protein essential for import of protein precursors into mitochondria.
  • Sequence similarities

    Belongs to the Tom40 family.
  • Cellular localization

    Mitochondrion outer membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • C19orf1 antibody
    • D19S1177E antibody
    • Haymaker protein antibody
    • Mitochondrial import receptor subunit TOM40 homolog antibody
    • Mitochondrial outer membrane protein antibody
    • Mitochondrial outer membrane protein TOM40 antibody
    • p38.5 antibody
    • PER EC1 antibody
    • PEREC1 antibody
    • Probable mitochondrial import receptor subunit TOM40 homolog antibody
    • Protein Haymaker antibody
    • TOM40 antibody
    • TOM40_HUMAN antibody
    • TOMM40 antibody
    • Translocase of outer membrane 40 kDa subunit homolog antibody
    • Translocase of outer mitochondrial membrane 40 antibody
    • Translocase of outer mitochondrial membrane 40 homolog (yeast) antibody
    • Translocase of outer mitochondrial membrane 40 homolog antibody
    • Translocase of outer mitochondrial membrane 40, yeast, homolog of antibody
    see all

Images

  • Paraffin-embedded human lung tissue stained for TOMM40 using ab235985 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human placenta tissue stained for TOMM40 using ab235985 at 1/100 dilution in immunohistochemical analysis.

References

ab235985 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235985.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up