Overview

  • Product name

    Anti-TOMM40L antibody [OTI6F3]
    See all TOMM40L primary antibodies
  • Description

    Mouse monoclonal [OTI6F3] to TOMM40L
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human TOMM40L aa 1-308. (NP_115550) produced in E.coli.
    Sequence:

    MGNTLGLAPMGTLPRRSPRREEPLPNPGSFDELHRLCKDVFPAQMEGVKL VVNKVLSSHFQVAHTIHMSALGLPGYHLHAAYAGDWQLSPTEVFPTVVGD MDSSGSLNAQVLLLLAERLRAKAVFQTQQAKFLTWQFDGEYRGDDYTATL TLGNPDLIGESVIMVAHFLQSLTHRLVLGGELVYHRRPGEEGAILTLAGK YSAVHWVATLNVGSGGAHASYYHRANEQVQVGVEFEANTRLQDTTFSFGY HLTLPQANMVFRGLVDSNWCVGAVLEKKMPPLPVTLALGAFLNHWRNRFH CGFSITVG


    Database link: Q969M1

  • Positive control

    • WB: HEK-293T transfected with pCMV6-ENTRY TOMM40L whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab236421 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500. Predicted molecular weight: 34 kDa.

Target

  • Relevance

    Potential channel-forming protein implicated in import of protein precursors into mitochondria Forms part of the preprotein translocase of the outer mitochondrial membrane (TOM complex) containing TOMM22, TOMM40, TOMM40L and TOMM70. Interacts with mitochondrial targeting sequences.
  • Cellular localization

    Mitochondrial outer membrane
  • Database links

  • Alternative names

    • FLJ12770 antibody
    • Mitochondrial import receptor subunit antibody
    • RP11 297K8.10 antibody
    • TOMM40 like antibody
    • TOMM40B antibody
    • Translocase of outer mitochondrial membrane 40 homolog (yeast) like antibody
    see all

Images

  • All lanes : Anti-TOMM40L antibody [OTI6F3] (ab236421) at 1/500 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with pCMV6-ENTRY control, cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with pCMV6-ENTRY TOMM40L, cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 34 kDa

References

ab236421 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236421.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up