Anti-TOPBP 1 antibody [OTI5C12] (ab236523)

Overview

  • Product name

    Anti-TOPBP 1 antibody [OTI5C12]
  • Description

    Mouse monoclonal [OTI5C12] to TOPBP 1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TOPBP 1 aa 892-1146. (NP_008958) produced in E.coli.
    Sequence:

    KEAQSEKEEAPKPLHKVVVCVSKKLSKKQSELNGIAASLGADYRWSFDET VTHFIYQGRPNDTNREYKSVKERGVHIVSEHWLLDCAQECKHLPESLYPH TYNPKMSLDISAVQDGRLCNSRLLSAVSSTKDDEPDPLILEENDVDNMAT NNKESAPSNGSGKNDSKGVLTQTLEMRENFQKQLQEIMSATSIVKPQGQR TSLSRSGCNSASSTPDSTRSARSGRSRVLEALRQSRQTVPDVNTEPSQNE QIIWD


    Database link: Q92547

  • Positive control

    • WB: pCMV6-ENTRY TOPBP 1 cDNA transfected HEK-293T cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    OTI5C12
  • Isotype

    IgG2a

Applications

Our Abpromise guarantee covers the use of ab236523 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000.

Target

Images

  • All lanes : Anti-TOPBP 1 antibody [OTI5C12] (ab236523) at 1/2000 dilution

    Lane 1 : pCMV6-ENTRY control cDNA transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY TOPBP 1 cDNA transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Lysates/proteins at 5 µg per lane.

References

ab236523 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236523.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up