Overview

  • Product name

    Anti-Topoisomerase II beta/TOP2B antibody
    See all Topoisomerase II beta/TOP2B primary antibodies
  • Description

    Rabbit polyclonal to Topoisomerase II beta/TOP2B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Chinese hamster
  • Immunogen

    Recombinant fragment corresponding to Human Topoisomerase II beta/TOP2B aa 1400-1626.
    Sequence:

    SPITNDGEDEFVPSDGLDKDEYTFSPGKSKATPEKSLHDKKSQDFGNLFS FPSYSQKSEDDSAKFDSNEEDSASVFSPSFGLKQTDKVPSKTVAAKKGKP SSDTVPKPKRAPKQKKVVEAVNSDSDSEFGIPKKTTTPKGKGRGAKKRKA SGSENEGDYNPGRKTSKTTSKKPKKTSFDQDSDVDIFPSDFPTEPPSLPR TGRARKEVKYFAESDEEEDDVDFAMFN


    Database link: Q02880-1

  • Positive control

    • IHC-P: Human cervical cancer tissue. ICC/IF: HeLa cells.
  • General notes

     This product was previously labelled as Topoisomerase II beta

     

Properties

Applications

Our Abpromise guarantee covers the use of ab235898 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/20 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    Control of topological states of DNA by transient breakage and subsequent rejoining of DNA strands. Topoisomerase II makes double-strand breaks. Indirectly ivolved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene.
  • Sequence similarities

    Belongs to the type II topoisomerase family.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm. Nucleus > nucleolus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Antigen MLAA 44 antibody
    • beta isozyme antibody
    • DNA topoisomerase 2 beta antibody
    • DNA topoisomerase 2-beta antibody
    • DNA topoisomerase II 180 kD antibody
    • DNA topoisomerase II antibody
    • DNA topoisomerase II beta antibody
    • DNA topoisomerase II beta isozyme antibody
    • Top 2 antibody
    • TOP 2B antibody
    • TOP IIB antibody
    • Top2 beta antibody
    • TOP2B antibody
    • TOP2B_HUMAN antibody
    • Top2beta antibody
    • TOPIIB antibody
    • Topo II beta antibody
    • Topoisomerase (DNA) II beta 180kDa antibody
    • Topoisomerase (DNA) II beta antibody
    • Topoisomerase IIb antibody
    • U937 associated antigen antibody
    see all

Images

  • Paraffin-embedded human cervical cancer tissue stained for Topoisimerase II beta using ab235898 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for Topoisomerase II beta/TOP2B (green) using ab235898 at 1/100 dilution in ICC/IF. Secondary antibody is an Alexa-Fluor® 488-conjugated Goat Anti-Rabbit IgG(H+L).

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the antibody overnight at 4°C. Counterstained with DAPI.

References

ab235898 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235898.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up