Anti-TOSO antibody (ab168968)
Key features and details
- Mouse polyclonal to TOSO
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-TOSO antibody
See all TOSO primary antibodies -
Description
Mouse polyclonal to TOSO -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human TOSO aa 1-390.
Sequence:MDFWLWPLYFLPVSGALRILPEVKVEGELGGSVTIKCPLPEMHVRIYLCR EMAGSGTCGTVVSTTNFIKAEYKGRVTLKQYPRKNLFLVEVTQLTESDSG VYACGAGMNTDRGKTQKVTLNVHSEYEPSWEEQPMPETPKWFHLPYLFQM PAYASSSKFVTRVTTPAQRGKVPPVHHSSPTTQITHRPRVSRASSVAGDK PRTFLPSTTASKISALEGLLKPQTPSYNHHTRLHRQRALDYGSQSGREGQ GFHILIPTILGLFLLALLGLVVKRAVERRKALSRRARRLAVRMRALESSQ RPRGSPRPRSQNNIYSACPRRARGADAAGTGEAPVPGPGAPLPPAPLQVS ESPWLHAPSLKTSCEYVSLYHQPAAMMEDSDSDDYINVPA
Database link: NP_005440.1 -
Positive control
- Human tonsil tissue; TOSO transfected 293T cell lysate.
-
General notes
This product was previously labelled as FAIM3
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Constituent: 100% PBS -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab168968 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 43 kDa. | |
| IHC-P | Use a concentration of 3 µg/ml. |
Target
-
Function
May play a role in the immune system processes. Protects cells from FAS-, TNF alpha- and FADD-induced apoptosis without increasing expression of the inhibitors of apoptosis BCL2 and BCLXL. Seems to activate an inhibitory pathway that prevents CASP8 activation following FAS stimulation, rather than blocking apoptotic signals downstream. May inhibit FAS-induced apoptosis by preventing CASP8 processing through CFLAR up-regulation. -
Tissue specificity
Expressed in lymph nodes, peripheral blood leukocytes, lung, thymus and kidneys. Very weak expression detected in spleen, liver, heart, and salivary gland. Expressed in lymphoid cell lines such as Jurkat cells, CemT4 cells, MolT-4 cells, HB11.19 cells, and Reh cells. No expression detected in nonhematopoietic cell lines, including HepG2 cells, 293 cells and Hela cells. -
Sequence similarities
Contains 1 Ig-like (immunoglobulin-like) domain. -
Domain
The Ig-like domain is required for the anti-apoptotic ability. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 9214 Human
- Omim: 606015 Human
- SwissProt: O60667 Human
- Unigene: 58831 Human
- Unigene: 728324 Human
-
Alternative names
- Faim3 antibody
- FAIM3_HUMAN antibody
- Fas apoptotic inhibitory molecule 3 antibody
see all
Images
-
Western blot - Anti-TOSO antibody (ab168968)All lanes : Anti-TOSO antibody (ab168968) at 1 µg/ml
Lane 1 : TOSO transfected 293T cell lysate
Lane 2 : Non-transfected 293T cell lysate
Lysates/proteins at 15 µl per lane.
Secondary
All lanes : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution
Predicted band size: 43 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TOSO antibody (ab168968)Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human tonsil tissue labeling TOSO with ab168968 at 3 μg/ml.
Protocols
Datasheets and documents
References (0)
ab168968 has not yet been referenced specifically in any publications.
