Overview

  • Product name

    Anti-TP53I11 antibody
  • Description

    Rabbit polyclonal to TP53I11
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human TP53I11 aa 1-41.
    Sequence:

    MAAKQPPPLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHR


    Database link: O14683

  • Positive control

    • ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234860 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.

Target

Images

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling TP53I11 (green) using ab234860 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab234860 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234860.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up