Overview

  • Product name

  • Description

    Rabbit polyclonal to TP53TG5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human TP53TG5 aa 190-262. N-terminal His-tag and GST-tag. Expressed in E.coli.
    Sequence:

    YRNRTPMGHMKQLDVADQWIWFEGLPTRIHLPAPRVMCRSSTLRWVKRRC TRFCSASLEMPMWHPYKVDVTWT


    Database link: Q9Y2B4

  • Positive control

    • WB: Recombinant human TP53TG5 protein; Mouse brain lysate. IHC-P: Human liver cancer, liver and esophagus cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233439 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 34 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    May play a significant role in p53/TP53-mediating signaling pathway.
  • Tissue specificity

    Highly expressed in heart, brain and small intestine. Less abundant in skeletal muscle, spleen, prostate, ovary and colon. A smaller transcript is expressed specifically in the testis.
  • Cellular localization

    Cytoplasm. Nucleus. Cell cycle dependent intracellular localization.
  • Information by UniProt
  • Database links

  • Alternative names

    • C20orf10 antibody
    • Chromosome 20 open reading frame 10 antibody
    • CLG01 antibody
    • dJ453C12.5 antibody
    • T53G5_HUMAN antibody
    • TP53 inducible gene 5 protein antibody
    • TP53 target 5 antibody
    • TP53 target gene 5 protein antibody
    • TP53-inducible gene 5 protein antibody
    • TP53-target gene 5 protein antibody
    • TP53TG5 antibody
    see all

Images

  • Anti-TP53TG5 antibody (ab233439) at 5 µg/ml + Recombinant human TP53TG5 protein

    Predicted band size: 34 kDa

  • Anti-TP53TG5 antibody (ab233439) at 5 µg/ml + Mouse brain lysate

    Predicted band size: 34 kDa

  • Formalin-fixed, paraffin-embedded human liver cancer tissue stained for TP53TG5 using ab233439 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for TP53TG5 using ab233439 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human esophagus cancer tissue stained for TP53TG5 using ab233439 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab233439 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233439.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up