Overview

  • Product name

  • Description

    Rabbit polyclonal to TPD52
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TPD52 aa 175-224.
    Sequence:

    KSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL


    Database link: P55327

  • Positive control

    • ICC/IF: A431 cells. WB: RT4 and U-251 MG cell lysate. Human liver and tonsil tissue lysate. IHC-P: Human prostate, cerebral cortex and kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab244523 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Tissue specificity

    Isoform 2 is expressed in colon, breast, prostate, pancreas and kidney tumor cell lines. Isoform 2 is expressed at high levels in kidney, prostate, brain, small intestine and pancreas, at moderate levels in placenta and colon, at low levels in lung, liver and heart, and at very low levels in spleen, thymus, peripheral mononuclear blood cells, testis and ovary.
  • Sequence similarities

    Belongs to the TPD52 family.
  • Developmental stage

    Isoform 2 is expressed at lower levels in fetal brain and kidney than in adult brain and kidney.
  • Information by UniProt
  • Database links

  • Alternative names

    • D52 antibody
    • hD52 antibody
    • Human 19.8 kDa protein mRNA, complete cds antibody
    • N8L antibody
    • PC 1 antibody
    • PC1 antibody
    • PC1/MRPS28 fusion protein antibody
    • PrLZ antibody
    • Prostate and colon associated protein antibody
    • Prostate leucine zipper antibody
    • Protein N8 antibody
    • TPD52 antibody
    • TPD52_HUMAN antibody
    • Tumor protein D52 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for TPD52 (green) using ab244523 at 4 µg/ml in ICC/IF.

  • All lanes : Anti-TPD52 antibody (ab244523) at 0.4 µg/ml

    Lane 1 : RT4 (Human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (Human brain glioma cell line) cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate
  • Paraffin-embedded human prostate tissue stained for TPD52 using ab244523 at 1/50 dilution in immunohistochemical analysis.
  • Paraffin-embedded human kidney tissue stained for TPD52 using ab244523 at 1/50 dilution in immunohistochemical analysis.
  • Paraffin-embedded human cerebral cortex tissue stained for TPD52 using ab244523 at 1/50 dilution in immunohistochemical analysis.
  • Paraffin-embedded human skeletal muscle tissue stained for TPD52 using ab244523 at 1/50 dilution in immunohistochemical analysis.

    Low expression as expected.

References

ab244523 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244523.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up