Overview

  • Product name

  • Description

    Rabbit polyclonal to TPD52L2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Common marmoset, Orangutan
  • Immunogen

    Recombinant fragment within Human TPD52L2 aa 156-206. The exact sequence is proprietary. NP_003279.2
    Sequence:

    GDMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAP F


    Database link: O43399

  • Positive control

    • HeLa, 293T and Jurkat whole cell lysates

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab194938 was affinity purified using an epitope specific to TPD52L2 immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab194938 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 22 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

Images

  • All lanes : Anti-TPD52L2 antibody (ab194938) at 0.4 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 22 kDa


    Exposure time: 3 minutes
  • Detection of Human TPD52L2 by Western Blot of Immunoprecipitates.

    Lane 1: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from 293T cells prepared using NETN lysis buffer. Antibodies: ab194938 used for IP at 6 μg per reaction. For blotting ab194938 was used at 1 μg/ml.

    Lane 2: Control IgG.

     

    Detection: Chemiluminescence with an exposure time of 3 minutes.

References

This product has been referenced in:

  • Zhuang Y  et al. The novel function of tumor protein D54 in regulating pyruvate dehydrogenase and metformin cytotoxicity in breast cancer. Cancer Metab 7:1 (2019). Read more (PubMed: 30697423) »
  • Chi Y  et al. microRNA-503 suppresses the migration, proliferation and colony formation of prostate cancer cells by targeting tumor protein D52 like 2. Exp Ther Med 15:473-478 (2018). Read more (PubMed: 29375699) »
See all 3 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194938.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up