Anti-TPD52L2 antibody (ab234819)
Key features and details
- Rabbit polyclonal to TPD52L2
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-TPD52L2 antibody
See all TPD52L2 primary antibodies -
Description
Rabbit polyclonal to TPD52L2 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Orangutan
-
Immunogen
Recombinant full length protein corresponding to Human TPD52L2 aa 1-206.
Sequence:MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELR AELTKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDV QVSSAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTVGSA ISRKLGDMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPL SDPAPF
Database link: O43399 -
Positive control
- IHC-P: Human pancreatic cancer and spleen tissues. ICC/IF: HepG2 cells. WB: Mouse spleen lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab234819 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/200 - 1/5000. Predicted molecular weight: 22 kDa. | |
| IHC-P | 1/20 - 1/200. | |
| ICC/IF | 1/50 - 1/200. |
Target
-
Sequence similarities
Belongs to the TPD52 family. - Information by UniProt
-
Database links
- Entrez Gene: 7165 Human
- Entrez Gene: 66314 Mouse
- Entrez Gene: 100172104 Orangutan
- Omim: 603747 Human
- SwissProt: O43399 Human
- SwissProt: Q9CYZ2 Mouse
- SwissProt: Q5RCT1 Orangutan
- Unigene: 473296 Human
see all -
Alternative names
- 2810411G23Rik antibody
- AU016537 antibody
- C86069 antibody
see all
Images
-
Western blot - Anti-TPD52L2 antibody (ab234819)Anti-TPD52L2 antibody (ab234819) at 1/200 dilution + Mouse spleen lysate
Secondary
Goat polyclonal to rabbit IgG at 1/50000 dilution
Predicted band size: 22 kDa -
Immunocytochemistry/ Immunofluorescence - Anti-TPD52L2 antibody (ab234819)HepG2 (human liver hepatocellular carcinoma cell line) cells stained for TPD52L2 green) using ab234819 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TPD52L2 antibody (ab234819)Paraffin-embedded human pancreatic cancer tissue stained for TPD52L2 using ab234819 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TPD52L2 antibody (ab234819)Paraffin-embedded human spleen tissue stained for TPD52L2 using ab234819 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab234819 has not yet been referenced specifically in any publications.
