Overview

  • Product name

  • Description

    Rabbit polyclonal to TPMT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Chimpanzee, Gorilla, African green monkey
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human TPMT aa 26-227. (Expressed in E.coli).
    Sequence:

    LEEWQDKWVNGKTAFHQEQGHQLLKKHLDTFLKGKSGLRVFFPLCGKAVE MKWFADRGHSVVGVEISELGIQEFFTEQNLSYSEEPITEIPGTKVFKSSS GNISLYCCSIFDLPRTNIGKFDMIWDRGALVAINPGDRKCYADTMFSLLG KKFQYLLCVLSYDPTKHPGPPFYVPHAEIERLFGKICNIRCLEKVDAFEE RH


    Database link: P51580

  • Positive control

    • IHC-P: Human pancreas, stomach, kidney liver cancer, prostate and glioma tissues. WB: Human lung lysate; Mouse kidney lysate; Recombinant human TPMT protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab233511 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233511 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 28 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Catalyzes the S-methylation of thiopurine drugs such as 6-mercaptopurine.
  • Involvement in disease

    Defects in TPMT are the cause of thiopurine S-methyltransferase deficiency (TPMT deficiency) [MIM:610460]. TPMT is an enzyme involved in the normal metabolic inactivation of thiopurine drugs. These drugs are generally used as immunosupressants or cytotoxic drugs and are prescribed for a variety of clinical conditions including leukemia, autoimmune disease and organ transplantation. Patients with intermediate or no TPMT activity are at risk of toxicity after receiving standard doses of thiopurine drugs and it is shown that inter-individual differences in response to these drugs are largely determined by genetic variation at the TPMT locus.
  • Sequence similarities

    Belongs to the methyltransferase superfamily. TPMT family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • HGNC:12014 antibody
    • S adenosyl L methionine thiopurine S methyltransferase antibody
    • Thiopurine methyltransferase antibody
    • Thiopurine S methyltransferase antibody
    • Thiopurine S-methyltransferase antibody
    • TPMT antibody
    • TPMT_HUMAN antibody
    see all

Images

  • Paraffin-embedded human pancreas tissue stained for TPMT using ab233511 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human stomach tissue stained for TPMT using ab233511 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human kidney tissue stained for TPMT using ab233511 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human liver cancer tissue stained for TPMT using ab233511 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human prostate tissue stained for TPMT using ab233511 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human glioma tissue stained for TPMT using ab233511 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-TPMT antibody (ab233511) at 1 µg/ml + Recombinant human TPMT protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 28 kDa

  • All lanes : Anti-TPMT antibody (ab233511) at 1 µg/ml

    Lane 1 : Human lung lysate
    Lane 2 : Mouse kidney lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 28 kDa

References

ab233511 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233511.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up