Overview

  • Product name

  • Description

    Rabbit polyclonal to TPMT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IP, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Gorilla
  • Immunogen

    Recombinant fragment corresponding to Human TPMT aa 4-244.
    Sequence:

    TRTSLDIEEYSDTEVQKNQVLTLEEWQDKWVNGKTAFHQEQGHQLLKKHL DTFLKGKSGLRVFFPLCGKAVEMKWFADRGHSVVGVEISELGIQEFFTEQ NLSYSEEPITEIPGTKVFKSSSGNISLYCCSIFDLPRTNIGKFDMIWDRG ALVAINPGDRKCYADTMFSLLGKKFQYLLCVLSYDPTKHPGPPFYVPHAE IERLFGKICNIRCLEKVDAFEERHKSWGIDCLFEKLYLLTE


    Database link: P51580

  • Positive control

    • WB: EC109 and HEK-293T whole cell lysates. IHC-P: Human kidney and brain tissues. IP: K562 whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab236648 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 28 kDa.
IP 1/200 - 1/2000.
IHC-P 1/20 - 1/200.

Target

  • Function

    Catalyzes the S-methylation of thiopurine drugs such as 6-mercaptopurine.
  • Involvement in disease

    Defects in TPMT are the cause of thiopurine S-methyltransferase deficiency (TPMT deficiency) [MIM:610460]. TPMT is an enzyme involved in the normal metabolic inactivation of thiopurine drugs. These drugs are generally used as immunosupressants or cytotoxic drugs and are prescribed for a variety of clinical conditions including leukemia, autoimmune disease and organ transplantation. Patients with intermediate or no TPMT activity are at risk of toxicity after receiving standard doses of thiopurine drugs and it is shown that inter-individual differences in response to these drugs are largely determined by genetic variation at the TPMT locus.
  • Sequence similarities

    Belongs to the methyltransferase superfamily. TPMT family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • HGNC:12014 antibody
    • S adenosyl L methionine thiopurine S methyltransferase antibody
    • Thiopurine methyltransferase antibody
    • Thiopurine S methyltransferase antibody
    • Thiopurine S-methyltransferase antibody
    • TPMT antibody
    • TPMT_HUMAN antibody
    see all

Images

  • All lanes : Anti-TPMT antibody (ab236648) at 1/1000 dilution

    Lane 1 : EC109 whole cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/50000 dilution

    Predicted band size: 28 kDa

  • Paraffin-embedded human kidney tissue stained for TPMT using ab236648 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human brain tissue stained for TPMT using ab236648 at 1/100 dilution in immunohistochemical analysis.

  • TPMT was immunoprecipitated from 500 µg K562 (human liver chronic myelogenous leukemia cell line from bone marrow) whole cell lysate with ab236648 at 1/200 dilution. 

    Lane 1: Rabbit control IgG IP in K562 whole cell lysate.

    Lane 2: ab236648 IP in K562 whole cell lysate.

    Lane 3: K562 whole cell lysate 20 µg (Input).

    For western blotting, an HRP-conjugated Protein G antibody was used as the secondary antibody at 1/2000 dilution.

References

ab236648 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236648.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up