Overview

  • Product name
  • Description
    Rabbit polyclonal to TPOR
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse TPOR aa 66-260. Two N-terminal tags. (Expressed in E.coli).
    Sequence:

    LYAYRGEKPRACPLYSQSVPTFGTRYVCQFPAQDEVRLFFPLHLWVKNVS LNQTLIQRVLFVDSVGLPAPPRVIKARGGSQPGELQIHWEAPAPEISDFL RHELRYGPTDSSNATAPSVIQLLSTETCCPTLWMPNPVPVLDQPPCVHPT ASQPHGPAPFLTVKGGSCLVSGLQAGKSYWLQLRSQPDGVSLRGS


    Database link: Q08351

  • Positive control
    • WB: HeLa cell lysate; Recombinant mouse TPOR protein. IHC-P: Mouse lung, pancreas, placenta and spleen tissues.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232755 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function
    Receptor for thrombopoietin. May represent a regulatory molecule specific for TPO-R-dependent immune responses.
  • Tissue specificity
    Expressed at a low level in a large number of cells of hematopoietic origin. Isoform 1 and isoform 2 are always found to be coexpressed.
  • Involvement in disease
    Defects in MPL are a cause of congenital amegakaryocytic thrombocytopenia (CAMT) [MIM:604498]. CAMT is a disease characterized by isolated thrombocytopenia and megakaryocytopenia with no physical anomalies.
  • Sequence similarities
    Belongs to the type I cytokine receptor family. Type 1 subfamily.
    Contains 2 fibronectin type-III domains.
  • Domain
    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • C MPL antibody
    • CD110 antibody
    • mpl antibody
    • MPLV antibody
    • Myeloproliferative leukemia protein antibody
    • Myeloproliferative leukemia virus oncogene antibody
    • Proto-oncogene c-Mpl antibody
    • THCYT2 antibody
    • Thrombopoietin receptor antibody
    • TPO R antibody
    • TPO-R antibody
    • TPOR antibody
    • TPOR_HUMAN antibody
    see all

Images

  • Anti-TPOR antibody (ab232755) at 2 µg/ml + Recombinant mouse TPOR protein

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution
  • Anti-TPOR antibody (ab232755) at 2 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution
  • Formalin-fixed, paraffin-embedded mouse pancreas tissue stained for TPOR using ab232755 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse lung tissue stained for TPOR using ab232755 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse spleen tissue stained for TPOR using ab232755 at 10 µg/ml in immunohistochemical analysis. AEC staining.

  • Formalin-fixed, paraffin-embedded mouse placenta tissue stained for TPOR using ab232755 at 10 µg/ml in immunohistochemical analysis. AEC staining.

References

ab232755 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232755.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up