Overview

  • Product name

  • Description

    Rabbit polyclonal to TPOR/MPL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse TPOR/MPL aa 66-260. Two N-terminal tags. (Expressed in E.coli).
    Sequence:

    LYAYRGEKPRACPLYSQSVPTFGTRYVCQFPAQDEVRLFFPLHLWVKNVS LNQTLIQRVLFVDSVGLPAPPRVIKARGGSQPGELQIHWEAPAPEISDFL RHELRYGPTDSSNATAPSVIQLLSTETCCPTLWMPNPVPVLDQPPCVHPT ASQPHGPAPFLTVKGGSCLVSGLQAGKSYWLQLRSQPDGVSLRGS


    Database link: Q08351

  • Positive control

    • WB: HeLa whole cell lysate (ab150035); Recombinant mouse TPOR/MPL protein. IHC-P: Mouse lung, pancreas, placenta and spleen tissues.
  • General notes

     This product was previously labelled as TPOR

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232755 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Receptor for thrombopoietin. May represent a regulatory molecule specific for TPO-R-dependent immune responses.
  • Tissue specificity

    Expressed at a low level in a large number of cells of hematopoietic origin. Isoform 1 and isoform 2 are always found to be coexpressed.
  • Involvement in disease

    Defects in MPL are a cause of congenital amegakaryocytic thrombocytopenia (CAMT) [MIM:604498]. CAMT is a disease characterized by isolated thrombocytopenia and megakaryocytopenia with no physical anomalies.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 1 subfamily.
    Contains 2 fibronectin type-III domains.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • C MPL antibody
    • CD110 antibody
    • mpl antibody
    • MPLV antibody
    • Myeloproliferative leukemia protein antibody
    • Myeloproliferative leukemia virus oncogene antibody
    • Proto-oncogene c-Mpl antibody
    • THCYT2 antibody
    • Thrombopoietin receptor antibody
    • TPO R antibody
    • TPO-R antibody
    • TPOR antibody
    • TPOR_HUMAN antibody
    see all

Images

  • Anti-TPOR/MPL antibody (ab232755) at 2 µg/ml + Recombinant mouse TPOR/MPL protein

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution
  • Anti-TPOR/MPL antibody (ab232755) at 2 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution
  • Formalin-fixed, paraffin-embedded mouse pancreas tissue stained for TPOR/MPL using ab232755 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse lung tissue stained for TPOR/MPL using ab232755 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse spleen tissue stained for TPOR/MPL using ab232755 at 10 µg/ml in immunohistochemical analysis. AEC staining.

  • Formalin-fixed, paraffin-embedded mouse placenta tissue stained for TPOR/MPL using ab232755 at 10 µg/ml in immunohistochemical analysis. AEC staining.

References

ab232755 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232755.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up