Overview

  • Product name

  • Description

    Rabbit polyclonal to TPPP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human TPPP aa 1-219.
    Sequence:

    MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSA LEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVF SKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPI ISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESG YVSGYKHAGTYDQKVQGGK


    Database link: O94811

  • Positive control

    • IHC-P: Human brain and glioma tissue.
  • General notes

    Previously labelled as Tubulin Polymerization Promoting Protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235774 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    May play a role in the polymerization of tubulin into microtubules, microtubule bundling and the stabilization of existing microtubules, thus maintaining the integrity of the microtubule network. May play a role in mitotic spindle assembly and nuclear envelope breakdown.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the TPPP family.
  • Post-translational
    modifications

    Poor substrate for GSK3 (By similarity). Phosphorylated by LIMK1 on serine residues. Phosphorylation may alter the tubulin polymerization activity.
  • Cellular localization

    Cytoplasm. Cytoplasm, cytoskeleton. Nucleus. Localizes to glial Lewy bodies in the brains of individuals with synucleinopathies.
  • Information by UniProt
  • Database links

  • Alternative names

    • 25 kDa brain specific protein antibody
    • 25 kDa brain-specific protein antibody
    • Brain specific protein p25 alpha antibody
    • Glycogen synthase kinase 3 (GSK3) inhibitor p24 antibody
    • OTTHUMP00000161630 antibody
    • p24 antibody
    • p25 antibody
    • p25-alpha antibody
    • p25alpha antibody
    • TPPP antibody
    • TPPP/p25 antibody
    • TPPP_HUMAN antibody
    • TPPP1 antibody
    • Tubulin polymerization promoting protein antibody
    • Tubulin polymerization-promoting protein antibody
    see all

Images

  • Paraffin-embedded human brain tissue stained for TPPP with ab235774 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human glioma tissue stained for TPPP with ab235774 at 1/100 dilution in immunohistochemical analysis.

References

ab235774 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235774.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up