Overview

  • Product name

  • Description

    Rabbit polyclonal to TPSB2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Mouse TPSB2 aa 32-276.
    Sequence:

    IVGGHEASESKWPWQVSLRFKLNYWIHFCGGSLIHPQWVLTAAHCVGPHI KSPQLFRVQLREQYLYYGDQLLSLNRIVVHPHYYTAEGGADVALLELEVP VNVSTHIHPISLPPASETFPPGTSCWVTGWGDIDNDEPLPPPYPLKQVKV PIVENSLCDRKYHTGLYTGDDFPIVHDGMLCAGNTRRDSCQGDSGGPLVC KVKGTWLQAGVVSWGEGCAQPNKPGIYTRVTYYLDWIHRY VPEHS


    Database link: P21845

  • Positive control

    • Mouse and rat heart lysates

Properties

Applications

Our Abpromise guarantee covers the use of ab193192 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Detects a band of approximately 31 kDa (predicted molecular weight: 31 kDa).
ELISA Use at an assay dependent concentration.

Target

  • Function

    Tryptase is the major neutral protease present in mast cells and is secreted upon the coupled activation-degranulation response of this cell type. Has an immunoprotective role during bacterial infection. Required to efficiently combat K.pneumoniae infection.
  • Sequence similarities

    Belongs to the peptidase S1 family. Tryptase subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization

    Secreted. Released from the secretory granules upon mast cell activation.
  • Information by UniProt
  • Database links

  • Alternative names

    • Mast cell tryptase beta II antibody
    • Mast cell tryptase beta III antibody
    • TPS2 antibody
    • TPSB2 antibody
    • TRYB2_HUMAN antibody
    • Tryptase beta 2 (gene/pseudogene) antibody
    • Tryptase beta-2 antibody
    • Tryptase II antibody
    • Tryptase-2 antibody
    • TryptaseB antibody
    • TryptaseC antibody
    see all

Images

  • All lanes : Anti-TPSB2 antibody (ab193192) at 2 µg/ml

    Lane 1 : Mouse heart tissue
    Lane 2 : Rat heart tissue

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 31 kDa
    Observed band size: 31 kDa

  • Anti-TPSB2 antibody (ab193192) at 2.5 µg/ml + Rat heart tissue

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 31 kDa

References

ab193192 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193192.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up