Overview

  • Product name

  • Description

    Rabbit polyclonal to TPSB2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Rat TPSB2 aa 30-274. Mature chain. Expressed in E.coli.
    Sequence:

    IVGGREASESKWPWQVSLRFKFSFWMHFCGGSLIHPQWVLTAAHCVGLHI KSPELFRVQLREQYLYYADQLLTVNRTVVHPHYYTVEDGADIALLELEIP VNVSTHIHPISLPPASETFPSGTSCWVTGWGDIDSDEPLLPPYPLKQVKV PIVENSLCDRKYHTGLYTGDDVPIVQDGMLCAGNTRSDSCQGDSGGPLVC KVKGTWLQAGVVSWGEGCAEANRPGIYTRVTYYLDWIHRYVPQRS


    Database link: P50343

  • Positive control

    • WB: Recombinant rat TPSB2 protein; Rat spleen lysate. IHC-P: Rat heart, kidney and testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab232787 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 31 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Tryptase is the major neutral protease present in mast cells and is secreted upon the coupled activation-degranulation response of this cell type. Has an immunoprotective role during bacterial infection. Required to efficiently combat K.pneumoniae infection.
  • Sequence similarities

    Belongs to the peptidase S1 family. Tryptase subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization

    Secreted. Released from the secretory granules upon mast cell activation.
  • Information by UniProt
  • Database links

  • Alternative names

    • Mast cell tryptase beta II antibody
    • Mast cell tryptase beta III antibody
    • TPS2 antibody
    • TPSB2 antibody
    • TRYB2_HUMAN antibody
    • Tryptase beta 2 (gene/pseudogene) antibody
    • Tryptase beta-2 antibody
    • Tryptase II antibody
    • Tryptase-2 antibody
    • TryptaseB antibody
    • TryptaseC antibody
    see all

Images

  • Anti-TPSB2 antibody (ab232787) at 2 µg/ml + Recombinant rat TPSB2 protein

    Predicted band size: 31 kDa

  • Anti-TPSB2 antibody (ab232787) at 1 µg/ml + Rat spleen lysate

    Predicted band size: 31 kDa

  • Formalin-fixed, paraffin-embedded rat heart tissue stained for TPSB2 using ab232787 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat kidney tissue stained for TPSB2 using ab232787 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat testis tissue stained for TPSB2 using ab232787 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab232787 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232787.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up