Overview

  • Product name

    Anti-TPSG1 antibody
  • Description

    Rabbit polyclonal to TPSG1
  • Host species

    Rabbit
  • Specificity

    ab201296 detects endogenous levels of TPSG1.
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human TPSG1 aa 136-181. The exact sequence is proprietary.
    Sequence:

    TLSSRILPVCLPEASDDFCPGIRCWVTGWGYTREGEPLPPPYSLRE


    Database link: Q9NRR2

  • Positive control

    • HEK293T, mouse Raw 264.7 and rat PC12 cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab201296 was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen and the purity is > 95% (by SDS-PAGE).
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab201296 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 34 kDa.

Target

  • Tissue specificity

    Expressed in many tissues.
  • Sequence similarities

    Belongs to the peptidase S1 family. Tryptase subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • gamma I antibody
    • gamma II antibody
    • lung tryptase antibody
    • mast cell protease II antibody
    • mast cell tryptase antibody
    • pituitary tryptase antibody
    • PRSS31 antibody
    • Serine protease 31 antibody
    • skin tryptase antibody
    • TMT antibody
    • Tpsg1 antibody
    • Transmembrane tryptase antibody
    • trpA antibody
    • TRYG1_HUMAN antibody
    • Tryptase gamma (EC:3.4.21.-) antibody
    • tryptase gamma 1 antibody
    • tryptase gamma antibody
    • Tryptase gamma heavy chain antibody
    • tryptase gamma I antibody
    • tryptase gamma II antibody
    • Tryptase gamma light chain antibody
    see all

Images

  • All lanes : Anti-TPSG1 antibody (ab201296)

    Lane 1 : HEK293T whole cell lysate
    Lane 2 : mouse Raw 264.7 whole cell lysate
    Lane 3 : rat PC12 whole cell lysate

    Predicted band size: 34 kDa

References

ab201296 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201296.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up