Overview

  • Product name

    Anti-TPST1 antibody
  • Description

    Rabbit polyclonal to TPST1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human TPST1 aa 283-370.
    Sequence:

    VERSTDQVIKPVNVGALSKWVGKIPPDVLQDMAVIAPMLAKLGYDPYANP PNYGKPDPKIIENTRRVYKGEFQLPDFLKEKPQTEQVE


    Database link: O60507

  • Positive control

    • WB: Rat liver; mouse liver and kidney tissue. IHC-P: Human lung cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224605 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 50 kDa (predicted molecular weight: 42 kDa).
IHC-P 1/20 - 1/200.

Target

Images

  • All lanes : Anti-TPST1 antibody (ab224605) at 1/500 dilution

    Lane 1 : Rat liver tissue lysate
    Lane 2 : Mouse liver tissue lysate
    Lane 3 : Mouse kidney tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 42 kDa
    Observed band size: 50 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human lung cancer tissue stained for TPST1 using ab224605 at 1/100 dilution in immunohistochemical analysis.

References

ab224605 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224605.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up