Overview

  • Product name

  • Description

    Rabbit polyclonal to TPX2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human TPX2 aa 213-349.
    Sequence:

    QELEKSMKMQQEVVEMRKKNEEFKKLALAGIGQPVKKSVSQVTKSVDFHF RTDERIKQHPKNQEEYKEVNFTSELRKHPSSPARVTKGCTIVKPFNLSQG KKRTFDETVSTYVPLAQQVEDFHKRTPNRYHLRSKKD


    Database link: Q9ULW0

  • Positive control

    • IHC-P: Human bone marrow tissue. WB: TPX2 overexpression HEK-293T lysate. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab223741 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 86 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Spindle assembly factor. Required for normal assembly of mitotic spindles. Required for normal assembly of microtubules during apoptosis. Required for chromatin and/or kinetochore dependent microtubule nucleation. Mediates AURKA localization to spindle microtubules. Activates AURKA by promoting its autophosphorylation at 'Thr-288' and protects this residue against dephosphorylation.
  • Tissue specificity

    Expressed in lung carcinoma cell lines but not in normal lung tissues.
  • Sequence similarities

    Belongs to the TPX2 family.
  • Developmental stage

    Exclusively expressed in proliferating cells from the transition G1/S until the end of cytokinesis.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus. Cytoplasm > cytoskeleton > spindle. Cytoplasm > cytoskeleton > spindle pole. During mitosis it is strictly associated with the spindle pole and with the mitotic spindle, whereas during S and G2, it is diffusely distributed throughout the nucleus. Is released from the nucleus in apoptotic cells and is detected on apoptotic microtubules.
  • Information by UniProt
  • Database links

  • Alternative names

    • C20ORF1 antibody
    • C20orf2 antibody
    • Chromosome 20 Open Reading Frame 1 antibody
    • Differentially expressed in cancerous and non-cancerous lung cells 2 antibody
    • Differentially expressed in cancerous and noncancerous lung cells 2 antibody
    • Differentially expressed in lung cells 2 antibody
    • Differentially expressed in lung cells antibody
    • DIL 2 antibody
    • DIL-2 antibody
    • DIL2 antibody
    • FLS353 antibody
    • GD:C20orf1 antibody
    • HCA 519 antibody
    • HCA519 antibody
    • HCTP 4 antibody
    • HCTP4 antibody
    • Hepatocellular carcinoma associated antigen 519 antibody
    • Hepatocellular carcinoma-associated antigen 519 antibody
    • p100 antibody
    • Preferentially expressed in colorectal cancer antibody
    • Protein fls353 antibody
    • REPP 86 antibody
    • repp86 antibody
    • Restricted expression proliferation associated protein 100 antibody
    • Restricted expression proliferation-associated protein 100 antibody
    • Targeting protein for Xklp2 antibody
    • TPX 2 antibody
    • TPX2 antibody
    • TPX2 microtubule associated homolog antibody
    • TPX2 microtubule associated protein homolog antibody
    • TPX2 microtubule nucleation factor antibody
    • TPX2_HUMAN antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for TPX2 using ab223741 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreas tissue stained for TPX2 using ab223741 at 1/50 dilution in immunohistochemical analysis.

  • Anti-TPX2 antibody (ab223741) at 0.4 µg + RH-30 cell lysates

    Predicted band size: 86 kDa

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for TPX2 (green) using ab223741 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human bone marrow tissue stained for TPX2 using ab223741 at 1/50 dilution in immunohistochemical analysis.

  • All lanes : Anti-TPX2 antibody (ab223741) at 1/100 dilution

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) lysate
    Lane 2 : TPX2 overexpression HEK-293T cell lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa))

    Predicted band size: 86 kDa

References

ab223741 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223741.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up