Overview

  • Product name

    Anti-TRAAK antibody - N-terminal
    See all TRAAK primary antibodies
  • Description

    Rabbit polyclonal to TRAAK - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Horse, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide within Human TRAAK aa 43-92 (N terminal). The exact sequence is proprietary. Isoform 2
    Sequence:

    LVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVA


    Database link: Q9NYG8-2

  • Positive control

    • Human colorectal tumor lysate.
  • General notes

    Previously labelled as KCNK4. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab182107 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 45 kDa.

Target

  • Relevance

    TRAAK belongs to the two pore domain potassium channel family and is an outward rectifying potassium channel. This channel produces rapidly activating and non-inactivating outward rectifier K(+) currents. It is activated by arachidonic acid and other naturally occurring unsaturated free fatty acids.
  • Cellular localization

    Membrane; Multi-pass membrane protein.
  • Database links

  • Alternative names

    • K2p4.1 antibody
    • K2P4.1 potassium channel antibody
    • KCNK 4 antibody
    • MGC144821 antibody
    • Potassium channel subfamily K member 4 antibody
    • Potassium inwardly rectifying channel subfamily K member 4 antibody
    • TRAAK antibody
    • TRAAK1 antibody
    • TRAAKt antibody
    • TWIK related arachidonic acid stimulated potassium channel protein antibody
    • Two pore K(+) channel KT4.1 antibody
    • Two pore K+ channel KT4.1 antibody
    • Two pore potassium channel KT4.1 antibody
    see all

Images

  • Anti-TRAAK antibody - N-terminal (ab182107) at 1 µg/ml + Human colorectal tumor lysate at 10 µg

    Predicted band size: 45 kDa

References

ab182107 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182107.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up