Overview

  • Product name

  • Description

    Rabbit polyclonal to TRAIL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Rat TRAIL aa 115-287. N-terminal His-tag and GST-tag. Expressed in E. coli.
    Sequence:

    PPLPRGRRPQRVAAHITGITRRSNLALIPISKDGKTLGQKIETWESSRRG HSFLNHVHLRNGELVIQEEGLYYIYSQTYYRFKEAKEASKTVSKDGGRIK QMVQYIYKYTSYPDPILLMKSARNSCWSREAEYGLYSIYQGGLFELKEND RIFVSVTNEHLMDLDHEASFFGA


    Database link: Q8K3G0

  • Positive control

    • WB: Recombinant rat TRAIL protein. MCF7 cell lysate. IHC-P: Rat kidney, intestine, stomach, ovary and testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab231063 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Cytokine that binds to TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and possibly also to TNFRSF11B/OPG. Induces apoptosis. Its activity may be modulated by binding to the decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and TNFRSF11B/OPG that cannot induce apoptosis.
  • Tissue specificity

    Widespread; most predominant in spleen, lung and prostate.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Apo 2 ligand antibody
    • APO 2L antibody
    • Apo-2 ligand antibody
    • Apo-2L antibody
    • APO2L antibody
    • CD253 antibody
    • CD253 antigen antibody
    • Chemokine tumor necrosis factor ligand superfamily member 10 antibody
    • Protein TRAIL antibody
    • TL2 antibody
    • TNF Related Apoptosis Inducing Ligand antibody
    • TNF related apoptosis inducing ligand TRAIL antibody
    • TNF-related apoptosis-inducing ligand antibody
    • TNF10_HUMAN antibody
    • TNFSF10 antibody
    • TRAIL antibody
    • Tumor necrosis factor (ligand) family member 10 antibody
    • Tumor Necrosis Factor (ligand) Superfamily Member 10 antibody
    • Tumor necrosis factor apoptosis inducing ligand splice variant delta antibody
    • Tumor necrosis factor ligand superfamily member 10 antibody
    see all

Images

  • Anti-TRAIL antibody (ab231063) at 3 µg/ml + MCF7 (Human breast adenocarcinoma cell line) cell lysate

    Developed using the ECL technique.
  • Formalin-fixed, paraffin-embedded rat intestine tissue stained for TRAIL with ab231063 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat kidney tissue stained for TRAIL with ab231063 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat ovary tissue stained for TRAIL with ab231063 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat testis tissue stained for TRAIL with ab231063 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat stomach tissue stained for TRAIL with ab231063 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-TRAIL antibody (ab231063) at 2 µg/ml + recombinant rat TRAIL protein

    Developed using the ECL technique.

References

This product has been referenced in:

  • Gong H  et al. Tumor necrosis factor-related apoptosis-inducing ligand inhibits the growth and aggressiveness of colon carcinoma via the exogenous apoptosis signaling pathway. Exp Ther Med 17:41-50 (2019). Read more (PubMed: 30651763) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231063.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up