Anti-TRAK2 antibody (ab96839)
Key features and details
- Rabbit polyclonal to TRAK2
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-TRAK2 antibody
See all TRAK2 primary antibodies -
Description
Rabbit polyclonal to TRAK2 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Synthetic peptide within Human TRAK2 aa 852-914. The exact sequence is proprietary.
Sequence:AQENGRCQEAEIGPQKPDSAVYLNSGSSLLGGLRRNQSLPVIMGSFAAPV CTSSPKMGVLKED
Database link: NP_055864 -
Positive control
- WB: HepG2 and Molt-4 cell lysates.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.00
Preservative: 0.01% Thimerosal (merthiolate)
Constituents: 1.21% Tris, 0.75% Glycine, 10% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab96839 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/500 - 1/3000. Predicted molecular weight: 101 kDa.
|
Notes |
---|
WB
1/500 - 1/3000. Predicted molecular weight: 101 kDa. |
Target
-
Function
May regulate endosome-to-lysosome trafficking of membrane cargo, including EGFR. -
Tissue specificity
Widely expressed, with highest expression in heart. -
Sequence similarities
Contains 1 HAP1 N-terminal domain. -
Post-translational
modificationsO-glycosylated. -
Cellular localization
Cytoplasm. Early endosome. Mitochondrion. Colocalizes with MGARP at the mitochondria. Translocates from the cytoplasm to the mitochondria in a MGARP-dependent manner. - Information by UniProt
-
Database links
- Entrez Gene: 66008 Human
- Omim: 607334 Human
- SwissProt: O60296 Human
- Unigene: 152774 Human
-
Alternative names
- ALS2CR 3 antibody
- ALS2CR3 antibody
- Amyotrophic lateral sclerosis 2 (juvenile) chromosome region candidate 3 antibody
see all
Images
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab96839 has not yet been referenced specifically in any publications.