Overview

  • Product name

  • Description

    Rabbit polyclonal to TRAK2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human TRAK2 aa 852-914. The exact sequence is proprietary.
    Sequence:

    AQENGRCQEAEIGPQKPDSAVYLNSGSSLLGGLRRNQSLPVIMGSFAAPV CTSSPKMGVLKED


    Database link: NP_055864

  • Positive control

    • WB: HepG2 and Molt-4 cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab96839 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/3000. Predicted molecular weight: 101 kDa.

Target

  • Function

    May regulate endosome-to-lysosome trafficking of membrane cargo, including EGFR.
  • Tissue specificity

    Widely expressed, with highest expression in heart.
  • Sequence similarities

    Contains 1 HAP1 N-terminal domain.
  • Post-translational
    modifications

    O-glycosylated.
  • Cellular localization

    Cytoplasm. Early endosome. Mitochondrion. Colocalizes with MGARP at the mitochondria. Translocates from the cytoplasm to the mitochondria in a MGARP-dependent manner.
  • Information by UniProt
  • Database links

  • Alternative names

    • ALS2CR 3 antibody
    • ALS2CR3 antibody
    • Amyotrophic lateral sclerosis 2 (juvenile) chromosome region candidate 3 antibody
    • Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 3 protein antibody
    • CALS C antibody
    • GRIF 1 antibody
    • GRIF1 antibody
    • KIAA0549 antibody
    • OIP98 antibody
    • Trafficking kinesin-binding protein 2 antibody
    • Trafficking protein kinesin binding 2 antibody
    • Trak2 antibody
    • TRAK2_HUMAN antibody
    see all

Images

  • All lanes : Anti-TRAK2 antibody (ab96839) at 1/1000 dilution

    Lane 1 : Hep G2 whole cell lysate
    Lane 2 : Molt-4 whole cell lysate

    Lysates/proteins at 30 µg per lane.

    Predicted band size: 101 kDa



    7.5% SDS PAGE

References

ab96839 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Answer

Thank you for your note confirming the credit note.

As I have asked previously (please see my last e-mail), could you please provide the RNA primer sequence or let us know the primer is designed based on which mRNA accession No?

Our QC lab is still investigating this issue and retesting ab96839. We have not received any similar complaint about this antibody so your co-operation would be much appreciated.

I am looking forward to hearing from you soon.

Read More

Answer

Thank you for your note. This is to let you know that I have just contacted and asked our Account Department to raise a credit note for you - for the cost of one vial of ab96839. For your information, the internal reference note for this credit is CN19269. You can use this credit in the near future for any of the products which are in the catalogue or you could get a full refund from the Distributor. I hope this helps and if I can assist further, please do not hesitate to contact me.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up