Overview

  • Product name

    Anti-Transglutaminase 2 antibody [TGM2/419]
    See all Transglutaminase 2 primary antibodies
  • Description

    Mouse monoclonal [TGM2/419] to Transglutaminase 2
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Monkey
  • Immunogen

    Recombinant full length protein corresponding to Human Transglutaminase 2 aa 1-687.
    Sequence:

    MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNY EASVDSLTFSVVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTL SLQLTTPANAPIGLYRLSLEASTGYQGSSFVLGHFILLFNAWCPADAVYL DSEEERQEYVLTQQGFIYQGSAKFIKNIPWNFGQFEDGILDICLILLDVN PKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGRWDNNYGDGVS PMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN YNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPG YEGWQALDPTPQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNAD VVDWIQQDDGSVHKSINRSLIVGLKISTKSVGRDEREDITHTYKYPEGSS EEREAFTRANHLNKLAEKEETGMAMRIRVGQSMNMGSDFDVFAHITNNTA EEYVCRLLLCARTVSYNGILGPECGTKYLLNLNLEPFSEKSVPLCILYEK YRDCLTESNLIKVRALLVEPVINSYLLAERDLYLENPEIKIRILGEPKQK RKLVAEVSLQNPLPVALEGCTFTVEGAGLTEEQKTVEIPDPVEAGEEVKV RMDLLPLHMGLHKLVVNFESDKLKAVKGFRNVIIGPA


    Database link: P21980

  • Positive control

    • Human tonsil, placenta, uterus and leiomyosarcoma tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab216018 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

(Primary incubation for 30 minutes at RT).

Target

  • Function

    Catalyzes the cross-linking of proteins and the conjugation of polyamines to proteins.
  • Sequence similarities

    Belongs to the transglutaminase superfamily. Transglutaminase family.
  • Information by UniProt
  • Database links

  • Alternative names

    • ALPHA SUBUNIT antibody
    • C polypeptide antibody
    • EC 2.3.2.13 antibody
    • epididymis secretory protein Li 45 antibody
    • G alpha h antibody
    • G[a]h antibody
    • Gh CLASS G ALPHA h antibody
    • GNAH antibody
    • GNAH G PROTEIN antibody
    • H POLYPEPTIDE antibody
    • HEL-S-45 antibody
    • Protein glutamine gamma glutamyltransferase 2 antibody
    • Protein-glutamine gamma-glutamyltransferase 2 antibody
    • TG 2 antibody
    • TG(C) antibody
    • TG2 antibody
    • TGase C antibody
    • TGase H antibody
    • TGase-2 antibody
    • TgaseII antibody
    • TGC antibody
    • TGC GUANINE NUCLEOTIDE BINDING PROTEIN antibody
    • TGM2 antibody
    • TGM2_HUMAN antibody
    • Tissue transglutaminase antibody
    • Transglutaminase 2 antibody
    • Transglutaminase 2 C polypeptide antibody
    • Transglutaminase C antibody
    • Transglutaminase H antibody
    • Transglutaminase-2 antibody
    • tTG antibody
    • tTGas antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human tonsil tissue labeling Transglutaminase 2 with ab216018 at 1 µg/ml.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human placenta tissue labeling Transglutaminase 2 with ab216018 at 1 µg/ml.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human uterus tissue labeling Transglutaminase 2 with ab216018 at 1 µg/ml.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human leiomyosarcoma tissue labeling Transglutaminase 2 with ab216018 at 1 µg/ml.

References

This product has been referenced in:

  • Shan H  et al. MicroRNA-214 suppresses the viability, migration and invasion of human colorectal carcinoma cells via targeting transglutaminase 2. Mol Med Rep 20:1459-1467 (2019). Read more (PubMed: 31173203) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216018.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up