Anti-Transglutaminase 2 antibody [TGM2/419] - BSA and Azide free (ab212882)

Overview

  • Product name

    Anti-Transglutaminase 2 antibody [TGM2/419] - BSA and Azide free
    See all Transglutaminase 2 primary antibodies
  • Description

    Mouse monoclonal [TGM2/419] to Transglutaminase 2 - BSA and Azide free
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, ICC/IF, Flow Cytmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Rabbit, Human, Monkey
  • Immunogen

    Recombinant full length protein corresponding to Human Transglutaminase 2 aa 1-687.
    Sequence:

    MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNY EASVDSLTFSV VTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDC TLSLQLTTPANAPIGLYRLSLEA STGYQGSSFVLGHFILLFNAWCPAD AVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPWN FGQFEDGILDICL ILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGRW D NNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLG IPTRVVTNY NSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVES WMTRPDLQPGYEGWQALDPTP QEKSEGTYCCGPVPVRAIKEGDLSTKY DAPFVFAEVNADVVDWIQQDDGSVHKSINRSLI VGLKISTKSVGRDER EDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVGQ SMN MGSDFDVFAHITNNTAEEYVCRLLLCARTVSYNGILGPECGTKYLLNLNL EPFSEKS VPLCILYEKYRDCLTESNLIKVRALLVEPVINSYLLAERDL YLENPEIKIRILGEPKQKR KLVAEVSLQNPLPVALEGCTFTVEGAGLT EEQKTVEIPDPVEAGEEVKVRMDLLPLHMGL HKLVVNFESDKLKAVKG FRNVIIGPA


    Database link: P21980

  • Positive control

    • Human tonsil, placenta, uterus and leiomyosarcoma tissue. HUVEC Cells. Endothelial cells in placenta, liver, brain, or breast carcinoma. Smooth muscle cells of any origin (e.g. intestine)

Properties

Applications

Our Abpromise guarantee covers the use of ab212882 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 0.5 - 1 µg/ml.
Flow Cyt Use 0.5-1µg for 106 cells.

in 0.1ml

Target

  • Function

    Catalyzes the cross-linking of proteins and the conjugation of polyamines to proteins.
  • Sequence similarities

    Belongs to the transglutaminase superfamily. Transglutaminase family.
  • Information by UniProt
  • Database links

  • Alternative names

    • ALPHA SUBUNIT antibody
    • C polypeptide antibody
    • EC 2.3.2.13 antibody
    • epididymis secretory protein Li 45 antibody
    • G alpha h antibody
    • G[a]h antibody
    • Gh CLASS G ALPHA h antibody
    • GNAH antibody
    • GNAH G PROTEIN antibody
    • H POLYPEPTIDE antibody
    • HEL-S-45 antibody
    • Protein glutamine gamma glutamyltransferase 2 antibody
    • Protein-glutamine gamma-glutamyltransferase 2 antibody
    • TG 2 antibody
    • TG(C) antibody
    • TG2 antibody
    • TGase C antibody
    • TGase H antibody
    • TGase-2 antibody
    • TgaseII antibody
    • TGC antibody
    • TGC GUANINE NUCLEOTIDE BINDING PROTEIN antibody
    • TGM2 antibody
    • TGM2_HUMAN antibody
    • Tissue transglutaminase antibody
    • Transglutaminase 2 antibody
    • Transglutaminase 2 C polypeptide antibody
    • Transglutaminase C antibody
    • Transglutaminase H antibody
    • Transglutaminase-2 antibody
    • tTG antibody
    • tTGas antibody
    see all

Images

  • Immunohistochemical analysis of formalin fixed, paraffin embedded Human tonsil tissue labeling Transglutaminase 2 with ab212882 at 1µg/ml.

  • Immunohistochemical analysis of formalin fixed, paraffin embedded Human placenta tissue labeling Transglutaminase 2 with ab212882 at 1µg/ml.

  • Immunohistochemical analysis of formalin fixed, paraffin embedded Human uterus tissue labeling Transglutaminase 2 with ab212882 at 1µg/ml.

  • Immunohistochemical analysis of formalin fixed, paraffin embedded Human leiomyosarcoma tissue labeling Transglutaminase 2 with ab212882 at 1µg/ml.

References

ab212882 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab212882.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up