Overview

  • Product name

    Anti-Transketolase antibody
    See all Transketolase primary antibodies
  • Description

    Rabbit polyclonal to Transketolase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Chimpanzee, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Transketolase aa 1-294. Expressed in E.coli. N-terminal tags.
    Sequence:

    MESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAV LFFHTMRYKSQDPRNPHNDRFVLSKGHAAPILYAVWAEAGFLAEAELLNL RKISSDLDGHPVPKQAFTDVATGSLGQGLGAACGMAYTGKYFDKASYRVY CLLGDGELSEGSVWEAMAFASIYKLDNLVAILDINRLGQSDPAPLQHQMD IYQKRCEAFGWHAIIVDGHSVEELCKAFGQAKHQPTAIIAKTFKGRGITG VEDKESWHGKPLPKNMAEQIIQEIYSQIQSKKKILATPPQEDAP


    Database link: P29401

  • Positive control

    • IHC-P: Human breast cancer, glioma, cerebrum, liver cancer, lung cancer, kidney and thyroid tissues. WB: A549 cell lysate; Recombinant human Transketolase protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab233179 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 68 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Anti-Transketolase antibody (ab233179) at 1 µg/ml + A549 (human lung carcinoma cell line) cell lysate

    Secondary
    HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 0.2 µg/ml

    Predicted band size: 68 kDa

  • Formalin-fixed, paraffin-embedded human thyroid tissue stained for Transketolase using ab233179 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for Transketolase using ab233179 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human glioma tissue stained for Transketolase using ab233179 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for Transketolase using ab233179 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver cancer tissue stained for Transketolase using ab233179 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human lung cancer tissue stained for Transketolase using ab233179 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for Transketolase using ab233179 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Anti-Transketolase antibody (ab233179) at 2 µg/ml + Recombinant human Transketolase protein

    Predicted band size: 68 kDa

References

ab233179 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233179.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up