Overview

  • Product name

    Anti-Transportin 1/MIP antibody
    See all Transportin 1/MIP primary antibodies
  • Description

    Rabbit polyclonal to Transportin 1/MIP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Cow Transportin 1/MIP aa 593-836. (Expressed in E.coli).
    Sequence:

    PLLECLSSVATALQSGFLPYCEPVYQRCVNLVQKTLAQAMLNNAQPDQYE APDKDFMIVALDLLSGLAEGLGGNIEQLVARSNILTLMYQCMQDKMPEVR QSSFALLGDLTKACFQHVKPCIADFMPILGTNLNPEFISVCNNATWAIGE ISIQMGIEMQPYIPMVLHQLVEIINRPNTPKTLLENTAITIGRLGYVCPQ EVAPMLQQFIRPWCTSLRNIRDNEEKDSAFRGICTMISVNPSGV


    Database link: Q3SYU7

  • Positive control

    • WB: HEK-293T and HeLa cell lysates; Recombinant cow Transportin 1/MIP protein. ICC/IF: HeLa cells.
  • General notes

     This product was previously labelled as Transportin 1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231669 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231669 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 102 kDa.
ICC/IF Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus (By similarity). Involved in nuclear import of M9-containing proteins. In vitro, binds directly to the M9 region of the heterogeneous nuclear ribonucleoproteins (hnRNP), A1 and A2 and mediates their nuclear import. Appears also to be involved in hnRNP A1/A2 nuclear export. Mediates the nuclear import of ribosomal proteins RPL23A, RPS7 and RPL5. Binds to a beta-like import receptor binding (BIB) domain of RPL23A. In vitro, mediates nuclear import of H2A, H2B, H3 and H4 histones, and SRP19. In case of HIV-1 infection, binds and mediates the nuclear import of HIV-1 Rev.
  • Sequence similarities

    Belongs to the importin beta family.
    Contains 8 HEAT repeats.
    Contains 1 importin N-terminal domain.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Importin 2 antibody
    • Importin beta 2 antibody
    • Importin beta-2 antibody
    • IPO 2 antibody
    • IPO2 antibody
    • Karyopherin (importin) beta 2 antibody
    • Karyopherin beta 2 antibody
    • Karyopherin beta-2 antibody
    • KPN B2 antibody
    • KPNB 2 antibody
    • KPNB2 antibody
    • M9 interacting protein antibody
    • M9 region interacting protein antibody
    • M9 region interaction protein antibody
    • MIP 1 antibody
    • MIP antibody
    • MIP1 antibody
    • OTTHUMP00000126960 antibody
    • OTTHUMP00000222024 antibody
    • OTTHUMP00000226224 antibody
    • TNPO 1 antibody
    • Tnpo1 antibody
    • TNPO1_HUMAN antibody
    • Transportin 1 antibody
    • Transportin antibody
    • Transportin-1 antibody
    • Transportin1 antibody
    • TRN antibody
    see all

Images

  • HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cells stained for Transportin 1/MIP using ab231669 at 20 µg/ml in ICC/IF.

  • Anti-Transportin 1/MIP antibody (ab231669) at 2 µg/ml + HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Predicted band size: 102 kDa

  • Anti-Transportin 1/MIP antibody (ab231669) at 2 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 102 kDa

  • Anti-Transportin 1/MIP antibody (ab231669) at 5 µg/ml + Recombinant cow Transportin 1/MIP protein

    Predicted band size: 102 kDa

References

ab231669 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231669.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up