Overview

  • Product name
  • Description
    Rabbit polyclonal to TRAP1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Cow, Human
  • Immunogen

    Recombinant full length protein corresponding to Human TRAP1 aa 1-704.
    Sequence:

    MARELRALLLWGRRLRPLLRAPALAAVPGGKPILCPRRTTAQLGPRRNPA WSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDI VARSLYSEKEVFIRELISNASDALEKLRHKLVSDGQALPEMEIHLQTNAE KGTITIQDTGIGMTQEELVSNLGTIARSGS KAFLDALQNQAEASSKII GQFGVGFYSAFMVADRVEVYSRSAAPGSLGYQWLSDGSGVFEIAEASGVR TGTKIIIHLKSDCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMNTLQAI WMMDPKDVREWQHEEFYRYVAQAHDKPRYTLHYKTDAPLNIRSIFYVPDM KPSMFDVSRELGSSVALYSRKVLIQTKATDILPKWLRFIRGVVDSEDIPL NLSRELLQESALIRKLRDVLQQRLIKFFIDQSKKDAEKYAKFFEDYGLFM REGIVTATEQEVKEDIAKLLRYESSALPSGQLTSLSEYASRMRAGTRNIY YLCAPNRHLAEHSPYYEAMKKKDTEVLFCFEQFDELTLLHLREFDKKKLI SVETDIVVDHYKEEKFEDRSPAAECLSEKETEELMAWMRNVLGSRVTNVK VTLRLDTHPAMVTVLEMGAARHFLRMQQLAKTQEERAQLLQPTLEINPRH ALIKKLNQLRASEPGLAQLLVDQIYENAMIAAGLVDDPRAMVGRLNELLV KALERH


    Database link: Q12931

  • Positive control
    • Heat shocked Hela, 3T3, MDBK and PC12 cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab176478 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Detects a band of approximately 72 kDa (predicted molecular weight: 80 kDa).

Target

Images

  • All lanes : Anti-TRAP1 antibody (ab176478) at 1/1000 dilution

    Lane 1 : Recombinant Human TRAP1 protein (His-tag)
    Lane 2 : Hela lysate (heat shocked)
    Lane 3 : PC12 lysate (heat shocked)
    Lane 4 : 3T3 lysate (heat shocked)
    Lane 5 : MDBK lysate (heat shocked)

    Predicted band size: 80 kDa

References

ab176478 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176478.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up