Overview

  • Product name

  • Description

    Rabbit polyclonal to TRAP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant full length protein corresponding to Human TRAP1 aa 60-704.
    Sequence:

    STQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEK EVFIRELISNASDALEKLRHKLVSDGQALPEMEIHLQTNAEKGTITIQDT GIGMTQEELVSNLGTIARSGSKAFLDALQNQAEASSKIIGQFGVGFYSAF MVADRVEVYSRSAAPGSLGYQWLSDGSGVFEIAEASGVRTGTKIIIHLKS DCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMNTLQAIWMMDPKDVREW QHEEFYRYVAQAHDKPRYTLHYKTDAPLNIRSIFYVPDMKPSMFDVSREL GSSVALYSRKVLIQTKATDILPKWLRFIRGVVDSEDIPLNLSRELLQESA LIRKLRDVLQQRLIKFFIDQSKKDAEKYAKFFEDYGLFMREGIVTATEQE VKEDIAKLLRYESSALPSGQLTSLSEYASRMRAGTRNIYYLCAPNRHLAE HSPYYEAMKKKDTEVLFCFEQFDELTLLHLREFDKKKLISVETDIVVDHY KEEKFEDRSPAAECLSEKETEELMAWMRNVLGSRVTNVKVTLRLDTHPAM VTVLEMGAARHFLRMQQLAKTQEERAQLLQPTLEINPRHALIKKLNQLRA SEPGLAQLLVDQIYENAMIAAGLVDDPRAMVGRLNELLVKALERH


    Database link: Q12931

  • Positive control

    • WB: HeLa cell lysate. ICC/IF: Heat shocked HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab223379 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Detects a band of approximately 75 kDa (predicted molecular weight: 74,80 kDa).
ICC/IF 1/120.

Target

Images

  • 2% formaldehyde-fixed heat shocked HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for TRAP1 (green) using ab223379 at 1/120 dilution in ICC/IF. Secondary: Goat Anti-Rabbit FITC at 1/200 dilution for 2 hours at RT. Counterstain: DAPI (blue) nuclear stain at 1/40000 for 2 hours RT. Heat shocked at 42°C for 1 hour.

    (A) DAPI nuclear stain (B) ab223379 (C) Merge.

  • Anti-TRAP1 antibody (ab223379) at 1/1000 dilution + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate at 12 µg

    Secondary
    Goat Anti-Rabbit IgG HRP at 1/2000 dilution

    Developed using the ECL technique.

    Predicted band size: 74,80 kDa
    Observed band size: 75 kDa
    why is the actual band size different from the predicted?


    Exposure time: 5 minutes


    Blocking buffer: 5% skimmed milk in TBST.

    Primary antibody was incubated for 2 hours, the secondary for 1 hour at RT.

  • 2% formaldehyde-fixed heat shocked HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for TRAP1 (green) using ab223379 at 1/120 dilution in ICC/IF. Secondary: Goat Anti-Rabbit FITC at 1/200 dilution for 2 hours at RT. Counterstain: DAPI (blue) nuclear stain at 1/40000 for 2 hours RT. Heat shocked at 42°C for 1 hour.

    (A) DAPI nuclear stain (B) ab223379 (C) Merge.

References

ab223379 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223379.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up