Overview

  • Product name

    Anti-TRAP100/MED24 antibody
    See all TRAP100/MED24 primary antibodies
  • Description

    Rabbit polyclonal to TRAP100/MED24
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Human TRAP100/MED24 aa 801-850. The exact sequence is proprietary. Synthetic peptide around Lys834 of Human TRAP100/MED24.
    Sequence:

    LMDPPGTALAKLAVWCALSSYSSHKGQASTRQKKRHREDIEDYISLFPLD


    Database link: O75448

  • Positive control

    • 293 cell extract; Human Brain, Cortex tissue.
  • General notes

     This product was previously labelled as TRAP100

     

Properties

Applications

Our Abpromise guarantee covers the use of ab194951 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 µg/ml.
WB 1/500 - 1/1000.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
  • Tissue specificity

    Ubiquitous. Abundant in skeletal muscle, heart and placenta.
  • Sequence similarities

    Belongs to the Mediator complex subunit 24 family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • CRSP complex subunit 4 antibody
    • Activator recruited cofactor 100 kDa component antibody
    • Activator-recruited cofactor 100 kDa component antibody
    • ARC100 antibody
    • Cofactor required for Sp1 transcriptional activation subunit 4 antibody
    • CRSP complex subunit 4 antibody
    • CRSP100 antibody
    • CRSP4 antibody
    • DRIP100 antibody
    • hTRAP100 antibody
    • KIAA0130 antibody
    • MED 24 antibody
    • MED24 antibody
    • MED24_HUMAN antibody
    • Mediator complex subunit 24 antibody
    • Mediator of RNA polymerase II transcription subunit 24 antibody
    • Mediator of RNA polymerase II transcription subunit 24 homolog antibody
    • MGC8748 antibody
    • OTTHUMP00000164458 antibody
    • OTTHUMP00000164460 antibody
    • THRAP4 antibody
    • Thyroid hormone receptor associated protein 4 antibody
    • Thyroid hormone receptor associated protein complex 100 kDa component antibody
    • Thyroid hormone receptor-associated protein 4 antibody
    • Thyroid hormone receptor-associated protein complex 100 kDa component antibody
    • Trap100 antibody
    • Trapp100 antibody
    • Vitamin D3 receptor interacting protein complex component DRIP100 antibody
    • Vitamin D3 receptor-interacting protein complex 100 kDa component antibody
    see all

Images

  • Anti-TRAP100/MED24 antibody (ab194951) at 1/500 dilution + 293 cell extract
  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human Brain, Cortex tissue labeling TRAP100/MED24 with ab194951 at 5 µg/ml.

References

ab194951 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194951.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up