Overview

  • Product name

  • Description

    Rabbit polyclonal to TRAP80
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Human
  • Immunogen

    Synthetic peptide within Human TRAP80 aa 175-225 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    QENKLQRDFNSELLRLRQHWKLRKVGDKILGDLSYRSAGSLFPHHGTFEV I


    Database link: Q9NVC6-1

  • Positive control

    • WB: Mouse spleen lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab216593 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 73 kDa.

Target

  • Function

    Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
  • Tissue specificity

    Ubiquitous.
  • Involvement in disease

    Defects in MED17 are the cause of microcephaly postnatal progressive with seizures and brain atrophy (MCPHSBA) [MIM:613668]. It is a disorder characterized by postnatal progressive microcephaly and severe developmental retardation associated with cerebral and cerebellar atrophy. Infants manifest swallowing difficulties leading to failure to thrive, jitteriness, poor visual fixation, truncal arching, seizures. There is no acquisition of developmental milestones and patients suffer from marked spasticity and profound retardation. Progressive microcephaly becomes evident few months after birth.
  • Sequence similarities

    Belongs to the Mediator complex subunit 17 family.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 77-KD subunit antibody
    • Activator recruited cofactor 77 kDa component antibody
    • Activator-recruited cofactor 77 kDa component antibody
    • ARC77 antibody
    • Cofactor required for Sp1 transcriptional activation subunit 6 antibody
    • cofactor required for Sp1 transcriptional activation, subunit 6, 77kDa antibody
    • CRSP complex subunit 6 antibody
    • CRSP6 antibody
    • CRSP77 antibody
    • DRIP80 antibody
    • med17 antibody
    • MED17_HUMAN antibody
    • Mediator complex subunit 17 antibody
    • Mediator of RNA polymerase II transcription subunit 17 antibody
    • Mediator of RNA polymerase II transcription subunit 17, S cerevisiae, homolog of antibody
    • Thyroid hormone receptor-associated protein complex 80 kDa component antibody
    • Thyroid hormone receptor-associated protein, 80-KD subunit antibody
    • Transcriptional coactivator CRSP77 antibody
    • Trap80 antibody
    • VITAMIN D RECEPTOR-INTERACTING PROTEIN, 80-KD antibody
    • Vitamin D3 receptor-interacting protein complex 80 kDa component antibody
    see all

Images

  • Anti-TRAP80 antibody (ab216593) at 1/300 dilution + mouse spleen lysate

    Developed using the ECL technique.

    Predicted band size: 73 kDa

References

ab216593 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216593.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up